Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NB22

Protein Details
Accession A0A2N6NB22    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-72QTPTPTPQPSRPNKRRAPNTAPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MAARRNERIDFPYPPQPGMAPHPQQHPAPGQPPMNVPQPQPPSGPGSQQQTPTPTPQPSRPNKRRAPNTAPSPATPAAVPAVTPGQAPVPTPPNAQSVPPPAAPAPVDDSNATPTQPPAKKSRTNTPWTPAEEQRLKQMRDAGNSWAEIAKDMHYAEFAEDESQALLNAIKDYENNKWKVIGQKVGKPAKACEQYAKEHFPDLFASTKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.36
4 0.34
5 0.35
6 0.39
7 0.36
8 0.39
9 0.44
10 0.46
11 0.46
12 0.47
13 0.45
14 0.42
15 0.39
16 0.41
17 0.38
18 0.36
19 0.39
20 0.38
21 0.41
22 0.38
23 0.35
24 0.37
25 0.4
26 0.4
27 0.38
28 0.37
29 0.35
30 0.34
31 0.36
32 0.32
33 0.33
34 0.34
35 0.36
36 0.36
37 0.35
38 0.36
39 0.37
40 0.38
41 0.37
42 0.37
43 0.42
44 0.49
45 0.55
46 0.64
47 0.68
48 0.72
49 0.75
50 0.82
51 0.83
52 0.82
53 0.81
54 0.78
55 0.77
56 0.74
57 0.68
58 0.58
59 0.55
60 0.46
61 0.38
62 0.28
63 0.21
64 0.15
65 0.12
66 0.12
67 0.07
68 0.08
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.09
76 0.12
77 0.13
78 0.14
79 0.16
80 0.18
81 0.18
82 0.18
83 0.18
84 0.18
85 0.2
86 0.19
87 0.18
88 0.15
89 0.15
90 0.15
91 0.13
92 0.14
93 0.12
94 0.13
95 0.12
96 0.13
97 0.15
98 0.15
99 0.14
100 0.1
101 0.1
102 0.17
103 0.19
104 0.22
105 0.26
106 0.32
107 0.39
108 0.43
109 0.53
110 0.52
111 0.57
112 0.58
113 0.57
114 0.55
115 0.53
116 0.54
117 0.46
118 0.46
119 0.45
120 0.41
121 0.45
122 0.47
123 0.43
124 0.41
125 0.45
126 0.4
127 0.39
128 0.4
129 0.34
130 0.29
131 0.28
132 0.27
133 0.21
134 0.17
135 0.15
136 0.14
137 0.11
138 0.11
139 0.11
140 0.11
141 0.1
142 0.1
143 0.09
144 0.09
145 0.08
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.07
156 0.07
157 0.07
158 0.09
159 0.13
160 0.21
161 0.29
162 0.3
163 0.31
164 0.32
165 0.36
166 0.42
167 0.45
168 0.45
169 0.43
170 0.48
171 0.57
172 0.62
173 0.62
174 0.56
175 0.53
176 0.54
177 0.55
178 0.5
179 0.5
180 0.48
181 0.52
182 0.57
183 0.59
184 0.51
185 0.48
186 0.46
187 0.39
188 0.36
189 0.31