Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MBS6

Protein Details
Accession B8MBS6   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-36TTNNKSTQRRITSRNPQWTYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 12, nucl 9, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020347  Pop8  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0006379  P:mRNA cleavage  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MASQTEDVIMTAEHTTTTNNKSTQRRITSRNPQWTYFKLQLIPHSNHPIKNFTIDPLTARAHLSSALSQFLGLMGTSIGIDILKIENPSSSSTVQQQQSAKRPIIEFPNVWIRVPKDDGAAVLAALSSWVGSLSSSAAAAAAAAGDVSEDGDGGVAWRVCAKGNYLNAIVHGSGKEVFDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.15
4 0.19
5 0.23
6 0.27
7 0.35
8 0.42
9 0.5
10 0.57
11 0.62
12 0.64
13 0.66
14 0.72
15 0.76
16 0.78
17 0.81
18 0.75
19 0.7
20 0.69
21 0.66
22 0.63
23 0.57
24 0.51
25 0.44
26 0.42
27 0.46
28 0.47
29 0.46
30 0.44
31 0.49
32 0.49
33 0.47
34 0.47
35 0.43
36 0.37
37 0.38
38 0.32
39 0.24
40 0.24
41 0.21
42 0.2
43 0.2
44 0.2
45 0.17
46 0.17
47 0.15
48 0.13
49 0.13
50 0.13
51 0.11
52 0.1
53 0.1
54 0.09
55 0.09
56 0.08
57 0.08
58 0.07
59 0.05
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.05
72 0.05
73 0.05
74 0.07
75 0.08
76 0.1
77 0.11
78 0.11
79 0.14
80 0.19
81 0.2
82 0.23
83 0.25
84 0.28
85 0.35
86 0.38
87 0.35
88 0.32
89 0.32
90 0.3
91 0.32
92 0.31
93 0.23
94 0.22
95 0.3
96 0.29
97 0.28
98 0.28
99 0.24
100 0.24
101 0.26
102 0.24
103 0.16
104 0.16
105 0.16
106 0.14
107 0.13
108 0.09
109 0.07
110 0.06
111 0.04
112 0.04
113 0.04
114 0.02
115 0.02
116 0.02
117 0.03
118 0.03
119 0.03
120 0.04
121 0.05
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.04
128 0.03
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.04
141 0.07
142 0.07
143 0.07
144 0.09
145 0.09
146 0.11
147 0.12
148 0.16
149 0.19
150 0.23
151 0.27
152 0.28
153 0.27
154 0.27
155 0.28
156 0.25
157 0.2
158 0.17
159 0.15
160 0.14