Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N6NWQ9

Protein Details
Accession A0A2N6NWQ9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-78VPKNKVSHSRKRMRQLANKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAALLPRIASPALLPIPRLPSLAGIASRLLPTLGIALPGISITIPTLLDDIWEGVLRAVPKNKVSHSRKRMRQLANKGLKDVNSLCQCPGCGAPKRMHRLCQNCLEGAYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.24
4 0.24
5 0.25
6 0.2
7 0.17
8 0.18
9 0.19
10 0.17
11 0.13
12 0.13
13 0.14
14 0.13
15 0.12
16 0.1
17 0.07
18 0.07
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.05
26 0.05
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.06
43 0.06
44 0.07
45 0.1
46 0.12
47 0.14
48 0.17
49 0.2
50 0.29
51 0.36
52 0.45
53 0.53
54 0.61
55 0.66
56 0.73
57 0.79
58 0.78
59 0.8
60 0.8
61 0.8
62 0.8
63 0.73
64 0.67
65 0.6
66 0.51
67 0.46
68 0.37
69 0.35
70 0.3
71 0.3
72 0.28
73 0.27
74 0.26
75 0.24
76 0.26
77 0.25
78 0.28
79 0.31
80 0.38
81 0.46
82 0.55
83 0.58
84 0.62
85 0.65
86 0.66
87 0.69
88 0.71
89 0.66
90 0.57