Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8LU37

Protein Details
Accession B8LU37    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-30HIHDRRVRTKYEKRKRTVLKKLWEFFTBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MVLHIHDRRVRTKYEKRKRTVLKKLWEFFTFCHVEFHVLMVNGTEATVVTAGNYHLPAEEILGNAFTVERLTIEDLEKIYGQTTALPHRSHIGSELDMEDSADDLDMDYSTDGTDLEDVTEENNLWDIVVPEPPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.77
4 0.83
5 0.87
6 0.87
7 0.88
8 0.86
9 0.85
10 0.85
11 0.84
12 0.78
13 0.7
14 0.61
15 0.51
16 0.49
17 0.41
18 0.31
19 0.28
20 0.24
21 0.23
22 0.21
23 0.21
24 0.16
25 0.14
26 0.13
27 0.11
28 0.11
29 0.08
30 0.08
31 0.06
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.04
38 0.04
39 0.05
40 0.06
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.04
54 0.03
55 0.03
56 0.03
57 0.04
58 0.05
59 0.06
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.09
71 0.13
72 0.17
73 0.17
74 0.18
75 0.21
76 0.21
77 0.19
78 0.2
79 0.18
80 0.14
81 0.15
82 0.16
83 0.13
84 0.13
85 0.12
86 0.1
87 0.07
88 0.07
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.05
103 0.06
104 0.06
105 0.06
106 0.07
107 0.08
108 0.07
109 0.07
110 0.08
111 0.08
112 0.07
113 0.08
114 0.09
115 0.09