Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N6P2I2

Protein Details
Accession A0A2N6P2I2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
177-196DPGKYRAHRVWKDKGHKTCYBasic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MIASPLLLVALAAYATATPVASAPAPAATEWTGLTIADDAVNWDGISMSAYRDPSNWQQDSSNETAVTERVSPNPASAAAAKGGDVGILSGPCSQGSCPDYNARFDLVYTFTAVPVPPSPDCPGCPPLTIFSSNSDIRVNDCGQCLRKKVGSSLGGSVPGGCYDFKACGRDQVICVDPGKYRAHRVWKDKGHKTCYKMKADSLGGCGFVKSRIIVHPENEVPCNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.06
8 0.07
9 0.07
10 0.07
11 0.08
12 0.09
13 0.09
14 0.11
15 0.1
16 0.11
17 0.11
18 0.11
19 0.1
20 0.09
21 0.1
22 0.08
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.07
34 0.06
35 0.07
36 0.1
37 0.11
38 0.12
39 0.12
40 0.17
41 0.24
42 0.32
43 0.31
44 0.3
45 0.31
46 0.32
47 0.37
48 0.36
49 0.3
50 0.21
51 0.2
52 0.2
53 0.18
54 0.17
55 0.13
56 0.11
57 0.11
58 0.14
59 0.14
60 0.14
61 0.14
62 0.13
63 0.13
64 0.12
65 0.12
66 0.1
67 0.1
68 0.09
69 0.08
70 0.08
71 0.06
72 0.05
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.09
83 0.12
84 0.12
85 0.14
86 0.19
87 0.2
88 0.22
89 0.23
90 0.19
91 0.17
92 0.15
93 0.15
94 0.11
95 0.1
96 0.11
97 0.1
98 0.09
99 0.09
100 0.09
101 0.09
102 0.08
103 0.11
104 0.09
105 0.11
106 0.13
107 0.14
108 0.15
109 0.18
110 0.2
111 0.18
112 0.19
113 0.17
114 0.17
115 0.19
116 0.19
117 0.17
118 0.16
119 0.2
120 0.19
121 0.2
122 0.19
123 0.16
124 0.16
125 0.19
126 0.18
127 0.14
128 0.16
129 0.18
130 0.21
131 0.24
132 0.26
133 0.26
134 0.28
135 0.27
136 0.28
137 0.32
138 0.32
139 0.3
140 0.3
141 0.28
142 0.26
143 0.24
144 0.22
145 0.14
146 0.11
147 0.1
148 0.07
149 0.07
150 0.08
151 0.11
152 0.12
153 0.15
154 0.15
155 0.2
156 0.22
157 0.23
158 0.23
159 0.25
160 0.25
161 0.24
162 0.25
163 0.21
164 0.2
165 0.22
166 0.27
167 0.24
168 0.29
169 0.34
170 0.44
171 0.5
172 0.56
173 0.62
174 0.67
175 0.75
176 0.78
177 0.81
178 0.79
179 0.78
180 0.76
181 0.76
182 0.75
183 0.73
184 0.67
185 0.62
186 0.6
187 0.58
188 0.55
189 0.49
190 0.41
191 0.35
192 0.31
193 0.28
194 0.22
195 0.18
196 0.17
197 0.13
198 0.15
199 0.18
200 0.24
201 0.27
202 0.28
203 0.35
204 0.38
205 0.41