Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N6NV73

Protein Details
Accession A0A2N6NV73    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
169-196FDRPPKGGDKRHRADRRKPPVRSRYGHTBasic
NLS Segment(s)
PositionSequence
170-191DRPPKGGDKRHRADRRKPPVRS
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MMGSAGGSAGSGTAKVDPACAVCQAPASQLCGCEAHALEVALSQAEDLYFPPAMRNVRSWVRRNARDYILGHFHTLSEPCKDAYALHLDTIKATCLARSGPSSPGPGSGNNNSTNVHVARARAEYRRNIDRAWALAVKRYPEVLNHFYSLVRITLPGDDDPAMKRVPGFDRPPKGGDKRHRADRRKPPVRSRYGHTQPSPQFPASPQFPMTPASSKAPPPMPQMPPPPPHVAHWQTPPPSPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.11
5 0.13
6 0.15
7 0.16
8 0.15
9 0.13
10 0.16
11 0.15
12 0.18
13 0.17
14 0.2
15 0.19
16 0.19
17 0.2
18 0.18
19 0.18
20 0.18
21 0.17
22 0.15
23 0.15
24 0.14
25 0.13
26 0.12
27 0.12
28 0.08
29 0.08
30 0.06
31 0.04
32 0.04
33 0.05
34 0.05
35 0.07
36 0.08
37 0.08
38 0.09
39 0.14
40 0.16
41 0.18
42 0.2
43 0.23
44 0.31
45 0.38
46 0.43
47 0.49
48 0.56
49 0.61
50 0.63
51 0.63
52 0.58
53 0.56
54 0.52
55 0.47
56 0.43
57 0.37
58 0.34
59 0.28
60 0.25
61 0.21
62 0.21
63 0.18
64 0.14
65 0.14
66 0.14
67 0.14
68 0.14
69 0.12
70 0.13
71 0.17
72 0.15
73 0.15
74 0.16
75 0.16
76 0.16
77 0.17
78 0.14
79 0.1
80 0.09
81 0.08
82 0.08
83 0.08
84 0.09
85 0.11
86 0.13
87 0.14
88 0.16
89 0.18
90 0.17
91 0.19
92 0.18
93 0.18
94 0.2
95 0.2
96 0.22
97 0.21
98 0.22
99 0.2
100 0.19
101 0.2
102 0.16
103 0.15
104 0.13
105 0.12
106 0.13
107 0.15
108 0.17
109 0.18
110 0.21
111 0.24
112 0.28
113 0.32
114 0.32
115 0.29
116 0.3
117 0.27
118 0.25
119 0.24
120 0.21
121 0.16
122 0.19
123 0.2
124 0.19
125 0.18
126 0.18
127 0.16
128 0.15
129 0.22
130 0.22
131 0.22
132 0.21
133 0.22
134 0.2
135 0.2
136 0.19
137 0.13
138 0.09
139 0.07
140 0.07
141 0.08
142 0.09
143 0.09
144 0.1
145 0.1
146 0.11
147 0.12
148 0.13
149 0.12
150 0.1
151 0.11
152 0.13
153 0.16
154 0.22
155 0.29
156 0.35
157 0.41
158 0.44
159 0.46
160 0.5
161 0.52
162 0.54
163 0.57
164 0.59
165 0.61
166 0.69
167 0.77
168 0.78
169 0.82
170 0.84
171 0.86
172 0.85
173 0.86
174 0.86
175 0.86
176 0.87
177 0.81
178 0.77
179 0.76
180 0.75
181 0.75
182 0.68
183 0.67
184 0.62
185 0.66
186 0.64
187 0.54
188 0.47
189 0.4
190 0.44
191 0.38
192 0.36
193 0.3
194 0.27
195 0.27
196 0.28
197 0.29
198 0.26
199 0.26
200 0.27
201 0.28
202 0.29
203 0.34
204 0.37
205 0.38
206 0.42
207 0.47
208 0.48
209 0.51
210 0.58
211 0.6
212 0.59
213 0.6
214 0.6
215 0.54
216 0.52
217 0.55
218 0.52
219 0.5
220 0.54
221 0.56
222 0.53