Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NF30

Protein Details
Accession A0A2N6NF30   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
295-318GAMVRPKRLVRRKVDKGKGRQTIDBasic
NLS Segment(s)
PositionSequence
292-314FKKGAMVRPKRLVRRKVDKGKGR
490-557RGGRGRGGGGRGRGGRGGGRGRGGGDVARPTGDKATENARKGKEANKGSRANHNRKAGHAKKMARGGF
Subcellular Location(s) nucl 8.5, cyto_nucl 7.5, cyto 5.5, mito 5, plas 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041800  ASCC2_CUE  
IPR003892  CUE  
IPR009060  UBA-like_sf  
Gene Ontology GO:0043130  F:ubiquitin binding  
Pfam View protein in Pfam  
PF02845  CUE  
PROSITE View protein in PROSITE  
PS51140  CUE  
CDD cd14364  CUE_ASCC2  
Amino Acid Sequences MPNLPSLAAYPPAEWRHRLSSAEWQSIQSAWVTLLQAYINSPHSVLANALSEEDSSLTRFLTTFAQEAASQDASHSPAPALLKAVIQVMDKWTSLELTTAFDTFDHLANLAKIYPKKLAAPVLSKAFTSSHAAAIESSLTALKKSLIVILDAGIRGDLKLAEARLAKLNPLLHASPEACMLFLAGDDFLDSLIVCYKVMNPPLRKIIIATLYLCLFGLVVAQPAKWSMLSDELFALKSAADQHKQGPISANDSLVPELVTSTPLLKVLLAKAEADGAATPNLKKRIMALEAFKKGAMVRPKRLVRRKVDKGKGRQTIDDADAEIHVHRMSQITQVQDLFPDLGAGFVAKCLDEYNEDVEKVVANLLSESLPSHLATADRSEGLSSSHQQPQPDMAPHSTPPQLPTRRNIYDDDELDRLTVDTAKLKLREDTGMADEAVEGWALMLTRNAGQMRRLEAKYAFSGQQRELGRTAWRDSGAEDSDAGEATASRGGRGRGGGGRGRGGRGGGRGRGGGDVARPTGDKATENARKGKEANKGSRANHNRKAGHAKKMARGGFPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.41
4 0.43
5 0.45
6 0.41
7 0.45
8 0.49
9 0.54
10 0.5
11 0.44
12 0.42
13 0.4
14 0.37
15 0.27
16 0.19
17 0.12
18 0.14
19 0.13
20 0.12
21 0.12
22 0.12
23 0.12
24 0.12
25 0.15
26 0.15
27 0.15
28 0.15
29 0.15
30 0.15
31 0.15
32 0.15
33 0.14
34 0.13
35 0.13
36 0.13
37 0.13
38 0.12
39 0.12
40 0.13
41 0.11
42 0.1
43 0.1
44 0.09
45 0.09
46 0.09
47 0.11
48 0.13
49 0.15
50 0.14
51 0.15
52 0.16
53 0.16
54 0.17
55 0.2
56 0.17
57 0.15
58 0.14
59 0.16
60 0.17
61 0.17
62 0.16
63 0.12
64 0.14
65 0.16
66 0.16
67 0.16
68 0.14
69 0.14
70 0.14
71 0.16
72 0.15
73 0.14
74 0.15
75 0.16
76 0.17
77 0.16
78 0.16
79 0.15
80 0.14
81 0.13
82 0.14
83 0.11
84 0.12
85 0.13
86 0.12
87 0.12
88 0.11
89 0.13
90 0.13
91 0.13
92 0.11
93 0.1
94 0.11
95 0.11
96 0.12
97 0.11
98 0.16
99 0.17
100 0.19
101 0.22
102 0.23
103 0.25
104 0.28
105 0.33
106 0.32
107 0.35
108 0.37
109 0.38
110 0.37
111 0.34
112 0.32
113 0.27
114 0.24
115 0.25
116 0.21
117 0.19
118 0.18
119 0.19
120 0.17
121 0.17
122 0.15
123 0.1
124 0.09
125 0.08
126 0.08
127 0.08
128 0.08
129 0.08
130 0.09
131 0.09
132 0.12
133 0.1
134 0.11
135 0.11
136 0.11
137 0.12
138 0.11
139 0.11
140 0.08
141 0.08
142 0.07
143 0.07
144 0.06
145 0.06
146 0.08
147 0.08
148 0.12
149 0.13
150 0.14
151 0.18
152 0.19
153 0.18
154 0.2
155 0.21
156 0.18
157 0.21
158 0.2
159 0.16
160 0.18
161 0.18
162 0.15
163 0.16
164 0.14
165 0.11
166 0.1
167 0.09
168 0.07
169 0.06
170 0.06
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.03
179 0.05
180 0.05
181 0.05
182 0.06
183 0.08
184 0.11
185 0.17
186 0.24
187 0.25
188 0.29
189 0.34
190 0.35
191 0.33
192 0.3
193 0.28
194 0.24
195 0.23
196 0.2
197 0.16
198 0.15
199 0.15
200 0.14
201 0.1
202 0.07
203 0.05
204 0.05
205 0.04
206 0.06
207 0.06
208 0.06
209 0.06
210 0.07
211 0.07
212 0.07
213 0.07
214 0.06
215 0.11
216 0.11
217 0.12
218 0.12
219 0.12
220 0.12
221 0.12
222 0.11
223 0.06
224 0.06
225 0.11
226 0.13
227 0.14
228 0.15
229 0.17
230 0.22
231 0.22
232 0.22
233 0.21
234 0.19
235 0.22
236 0.21
237 0.2
238 0.16
239 0.16
240 0.15
241 0.12
242 0.1
243 0.06
244 0.06
245 0.06
246 0.05
247 0.05
248 0.06
249 0.06
250 0.06
251 0.06
252 0.06
253 0.06
254 0.07
255 0.08
256 0.08
257 0.07
258 0.07
259 0.07
260 0.07
261 0.06
262 0.06
263 0.05
264 0.06
265 0.06
266 0.07
267 0.1
268 0.13
269 0.13
270 0.13
271 0.14
272 0.17
273 0.19
274 0.21
275 0.22
276 0.27
277 0.29
278 0.29
279 0.27
280 0.23
281 0.21
282 0.23
283 0.27
284 0.25
285 0.29
286 0.37
287 0.43
288 0.52
289 0.61
290 0.64
291 0.65
292 0.7
293 0.75
294 0.77
295 0.8
296 0.8
297 0.8
298 0.82
299 0.8
300 0.72
301 0.63
302 0.55
303 0.49
304 0.42
305 0.33
306 0.24
307 0.16
308 0.14
309 0.13
310 0.11
311 0.08
312 0.06
313 0.06
314 0.06
315 0.06
316 0.07
317 0.11
318 0.14
319 0.14
320 0.16
321 0.16
322 0.16
323 0.15
324 0.15
325 0.1
326 0.08
327 0.07
328 0.05
329 0.05
330 0.05
331 0.05
332 0.04
333 0.04
334 0.04
335 0.04
336 0.04
337 0.04
338 0.05
339 0.07
340 0.08
341 0.13
342 0.14
343 0.14
344 0.14
345 0.14
346 0.13
347 0.11
348 0.11
349 0.06
350 0.05
351 0.05
352 0.06
353 0.06
354 0.06
355 0.06
356 0.06
357 0.07
358 0.07
359 0.07
360 0.07
361 0.08
362 0.08
363 0.1
364 0.1
365 0.1
366 0.1
367 0.1
368 0.09
369 0.11
370 0.13
371 0.14
372 0.17
373 0.24
374 0.26
375 0.26
376 0.27
377 0.29
378 0.31
379 0.31
380 0.29
381 0.24
382 0.25
383 0.26
384 0.29
385 0.27
386 0.24
387 0.24
388 0.3
389 0.36
390 0.37
391 0.41
392 0.46
393 0.47
394 0.48
395 0.48
396 0.45
397 0.44
398 0.42
399 0.4
400 0.33
401 0.29
402 0.27
403 0.24
404 0.18
405 0.12
406 0.11
407 0.09
408 0.11
409 0.13
410 0.18
411 0.2
412 0.21
413 0.23
414 0.24
415 0.25
416 0.23
417 0.23
418 0.21
419 0.21
420 0.19
421 0.17
422 0.14
423 0.13
424 0.11
425 0.08
426 0.05
427 0.04
428 0.04
429 0.04
430 0.05
431 0.05
432 0.06
433 0.07
434 0.11
435 0.13
436 0.14
437 0.17
438 0.2
439 0.26
440 0.33
441 0.32
442 0.32
443 0.32
444 0.35
445 0.35
446 0.36
447 0.34
448 0.3
449 0.34
450 0.31
451 0.36
452 0.34
453 0.33
454 0.31
455 0.29
456 0.3
457 0.3
458 0.32
459 0.29
460 0.29
461 0.26
462 0.26
463 0.3
464 0.26
465 0.23
466 0.2
467 0.17
468 0.17
469 0.16
470 0.15
471 0.09
472 0.07
473 0.07
474 0.1
475 0.09
476 0.1
477 0.13
478 0.14
479 0.16
480 0.17
481 0.2
482 0.21
483 0.27
484 0.3
485 0.3
486 0.36
487 0.36
488 0.37
489 0.34
490 0.31
491 0.29
492 0.31
493 0.34
494 0.31
495 0.31
496 0.3
497 0.3
498 0.29
499 0.28
500 0.22
501 0.2
502 0.2
503 0.19
504 0.19
505 0.19
506 0.2
507 0.22
508 0.22
509 0.2
510 0.19
511 0.29
512 0.35
513 0.4
514 0.46
515 0.45
516 0.48
517 0.5
518 0.55
519 0.54
520 0.57
521 0.61
522 0.63
523 0.68
524 0.67
525 0.74
526 0.78
527 0.78
528 0.77
529 0.77
530 0.7
531 0.7
532 0.78
533 0.74
534 0.73
535 0.72
536 0.7
537 0.69
538 0.75
539 0.71