Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NFG4

Protein Details
Accession A0A2N6NFG4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-33NAPRKRQKVASACERCRKRKLGCDRERPCQLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MNAPRKRQKVASACERCRKRKLGCDRERPCQLCVRAGAECVARDPGSQNPAPSSSKRAAADTEHAPPSTGLGNNAGARSSGGDLLLPESSIVDLTALEETKSSTGNRPGADTGDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.8
4 0.79
5 0.78
6 0.75
7 0.75
8 0.78
9 0.79
10 0.8
11 0.84
12 0.82
13 0.83
14 0.84
15 0.76
16 0.68
17 0.64
18 0.55
19 0.48
20 0.44
21 0.38
22 0.29
23 0.27
24 0.26
25 0.2
26 0.18
27 0.15
28 0.15
29 0.12
30 0.11
31 0.12
32 0.13
33 0.17
34 0.17
35 0.17
36 0.16
37 0.19
38 0.21
39 0.2
40 0.22
41 0.2
42 0.23
43 0.23
44 0.23
45 0.21
46 0.2
47 0.23
48 0.2
49 0.22
50 0.19
51 0.19
52 0.18
53 0.17
54 0.16
55 0.14
56 0.12
57 0.09
58 0.1
59 0.12
60 0.12
61 0.13
62 0.12
63 0.1
64 0.1
65 0.1
66 0.09
67 0.08
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.04
80 0.04
81 0.05
82 0.07
83 0.07
84 0.07
85 0.07
86 0.09
87 0.09
88 0.12
89 0.13
90 0.17
91 0.24
92 0.29
93 0.3
94 0.32
95 0.33