Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NWI9

Protein Details
Accession A0A2N6NWI9   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
42-74GAQKCCAPSAKRKRRIPQGGKPKCKNKRRRSSAHydrophilic
NLS Segment(s)
PositionSequence
51-74AKRKRRIPQGGKPKCKNKRRRSSA
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MCKRHHTQKQAIPVPRNKGKIGTMTTEKRNVEDVSEQKIDNGAQKCCAPSAKRKRRIPQGGKPKCKNKRRRSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.72
3 0.69
4 0.59
5 0.54
6 0.48
7 0.46
8 0.42
9 0.38
10 0.38
11 0.39
12 0.42
13 0.44
14 0.42
15 0.37
16 0.37
17 0.31
18 0.26
19 0.26
20 0.25
21 0.24
22 0.25
23 0.24
24 0.21
25 0.21
26 0.2
27 0.2
28 0.21
29 0.16
30 0.17
31 0.18
32 0.18
33 0.19
34 0.23
35 0.2
36 0.28
37 0.39
38 0.48
39 0.57
40 0.66
41 0.74
42 0.81
43 0.89
44 0.88
45 0.87
46 0.88
47 0.88
48 0.9
49 0.9
50 0.9
51 0.89
52 0.9
53 0.91
54 0.91