Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N6P1H0

Protein Details
Accession A0A2N6P1H0    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-26ADQESSPSRRRPRQSSPPSSSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001373  Cullin_N  
IPR016159  Cullin_repeat-like_dom_sf  
Gene Ontology GO:0031625  F:ubiquitin protein ligase binding  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00888  Cullin  
Amino Acid Sequences MHSLADQESSPSRRRPRQSSPPSSSLAPPSKRPKFADASMASATVRGKLPEIIDLSEQPSAFQPHAGAKKLVIKNLRRPGNRDAQIEQYYARTEKNLDEGLSAIFAGQKPAVPLEKLYRGVEDVCRKGSAEKVYRLLMKRIEKHLQSVVLPRIGKPGGAPQVDILRNVLAEWKLWNSQTVLIGIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.71
4 0.78
5 0.84
6 0.86
7 0.84
8 0.79
9 0.74
10 0.67
11 0.6
12 0.57
13 0.55
14 0.48
15 0.49
16 0.55
17 0.59
18 0.63
19 0.63
20 0.61
21 0.58
22 0.57
23 0.58
24 0.49
25 0.47
26 0.41
27 0.38
28 0.31
29 0.26
30 0.24
31 0.16
32 0.16
33 0.11
34 0.12
35 0.13
36 0.14
37 0.16
38 0.17
39 0.16
40 0.16
41 0.17
42 0.18
43 0.18
44 0.17
45 0.13
46 0.14
47 0.15
48 0.13
49 0.13
50 0.12
51 0.16
52 0.2
53 0.22
54 0.2
55 0.19
56 0.28
57 0.29
58 0.33
59 0.34
60 0.35
61 0.43
62 0.51
63 0.58
64 0.51
65 0.54
66 0.55
67 0.58
68 0.58
69 0.51
70 0.44
71 0.43
72 0.42
73 0.38
74 0.33
75 0.24
76 0.2
77 0.18
78 0.16
79 0.1
80 0.1
81 0.1
82 0.13
83 0.12
84 0.11
85 0.11
86 0.11
87 0.1
88 0.09
89 0.08
90 0.05
91 0.05
92 0.05
93 0.06
94 0.05
95 0.06
96 0.06
97 0.08
98 0.09
99 0.08
100 0.1
101 0.13
102 0.18
103 0.2
104 0.2
105 0.19
106 0.19
107 0.2
108 0.25
109 0.27
110 0.25
111 0.24
112 0.24
113 0.24
114 0.24
115 0.27
116 0.29
117 0.29
118 0.31
119 0.32
120 0.35
121 0.4
122 0.41
123 0.41
124 0.4
125 0.42
126 0.44
127 0.48
128 0.52
129 0.48
130 0.5
131 0.49
132 0.44
133 0.39
134 0.39
135 0.36
136 0.34
137 0.33
138 0.29
139 0.31
140 0.29
141 0.27
142 0.21
143 0.26
144 0.28
145 0.28
146 0.28
147 0.25
148 0.33
149 0.33
150 0.33
151 0.26
152 0.19
153 0.19
154 0.18
155 0.2
156 0.13
157 0.13
158 0.15
159 0.17
160 0.2
161 0.21
162 0.23
163 0.2
164 0.23
165 0.24
166 0.24