Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NPG7

Protein Details
Accession A0A2N6NPG7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-111GYLSRKRTRTGRAILKRRRQKGRAKLGCHBasic
NLS Segment(s)
PositionSequence
79-107KRRHGYLSRKRTRTGRAILKRRRQKGRAK
Subcellular Location(s) mito 25, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MQALARIARPVLTCKALPIRPSAMTAFTPLLPSTTATATAVDVVAPWAISAHPALAGGASQIRCGPRNTMNGATRLVQKRRHGYLSRKRTRTGRAILKRRRQKGRAKLGCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.35
3 0.35
4 0.35
5 0.35
6 0.34
7 0.32
8 0.34
9 0.31
10 0.25
11 0.23
12 0.24
13 0.21
14 0.17
15 0.17
16 0.14
17 0.14
18 0.12
19 0.12
20 0.11
21 0.1
22 0.1
23 0.09
24 0.1
25 0.09
26 0.09
27 0.08
28 0.06
29 0.05
30 0.05
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.06
46 0.05
47 0.06
48 0.07
49 0.09
50 0.11
51 0.12
52 0.15
53 0.18
54 0.22
55 0.26
56 0.31
57 0.32
58 0.32
59 0.33
60 0.31
61 0.34
62 0.37
63 0.39
64 0.39
65 0.44
66 0.49
67 0.52
68 0.58
69 0.58
70 0.62
71 0.67
72 0.72
73 0.75
74 0.72
75 0.72
76 0.71
77 0.72
78 0.7
79 0.69
80 0.69
81 0.69
82 0.76
83 0.81
84 0.85
85 0.88
86 0.89
87 0.89
88 0.87
89 0.87
90 0.87
91 0.89