Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8LTC5

Protein Details
Accession B8LTC5   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDPKIERRKALQKRNRRMKSLLHydrophilic
NLS Segment(s)
PositionSequence
7-17RRKALQKRNRR
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MDPKIERRKALQKRNRRMKSLLLKAVDMSILCDAEIFLGIRIRETGRVTTFCSDPEGLWSPATLKLKNYYPIPINMTLEDFQHGRGRNKDQDPESAIDEAGGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.85
4 0.78
5 0.77
6 0.78
7 0.76
8 0.72
9 0.63
10 0.56
11 0.5
12 0.46
13 0.36
14 0.25
15 0.17
16 0.11
17 0.09
18 0.08
19 0.07
20 0.07
21 0.06
22 0.07
23 0.05
24 0.05
25 0.07
26 0.07
27 0.07
28 0.08
29 0.09
30 0.11
31 0.12
32 0.14
33 0.14
34 0.16
35 0.18
36 0.19
37 0.18
38 0.16
39 0.17
40 0.15
41 0.12
42 0.15
43 0.16
44 0.15
45 0.15
46 0.15
47 0.14
48 0.18
49 0.21
50 0.18
51 0.16
52 0.19
53 0.22
54 0.26
55 0.26
56 0.26
57 0.25
58 0.28
59 0.31
60 0.3
61 0.28
62 0.25
63 0.26
64 0.23
65 0.21
66 0.2
67 0.16
68 0.15
69 0.19
70 0.23
71 0.26
72 0.31
73 0.38
74 0.45
75 0.51
76 0.57
77 0.54
78 0.56
79 0.55
80 0.52
81 0.47
82 0.39
83 0.33
84 0.25