Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NWP6

Protein Details
Accession A0A2N6NWP6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-62APAAGAKKQKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
40-57AGAKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 14, mito 10, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MWANQALQKIGCVPYTAQLLGQACPATASGAGPIAEAPAAGAKKQKKKWSKGKVKDKAQHAVILDKSTADKLYKDVQSYRLVTVAVLVDRMKINGSLARKCISDLEEKGMIKPVTTHSKMKIYTRAIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.2
4 0.17
5 0.19
6 0.2
7 0.19
8 0.2
9 0.16
10 0.13
11 0.13
12 0.13
13 0.09
14 0.08
15 0.08
16 0.06
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.06
24 0.05
25 0.07
26 0.07
27 0.08
28 0.14
29 0.21
30 0.3
31 0.37
32 0.46
33 0.52
34 0.62
35 0.72
36 0.78
37 0.82
38 0.84
39 0.89
40 0.89
41 0.9
42 0.86
43 0.81
44 0.76
45 0.65
46 0.58
47 0.47
48 0.41
49 0.32
50 0.26
51 0.2
52 0.14
53 0.13
54 0.11
55 0.11
56 0.08
57 0.08
58 0.09
59 0.15
60 0.17
61 0.19
62 0.2
63 0.22
64 0.27
65 0.28
66 0.26
67 0.21
68 0.19
69 0.17
70 0.16
71 0.14
72 0.09
73 0.09
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.09
81 0.12
82 0.17
83 0.18
84 0.21
85 0.22
86 0.22
87 0.23
88 0.24
89 0.23
90 0.26
91 0.25
92 0.28
93 0.31
94 0.31
95 0.31
96 0.36
97 0.33
98 0.26
99 0.26
100 0.27
101 0.31
102 0.35
103 0.39
104 0.37
105 0.45
106 0.49
107 0.52
108 0.55
109 0.5