Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H9CNM2

Protein Details
Accession H9CNM2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-30LNIIKSKLNTSYKKKRSNNKNVTISYKNFHydrophilic
67-96FSLSNLKLEKKLRKEKLRRRSIKLSTNKIFHydrophilic
NLS Segment(s)
PositionSequence
75-88EKKLRKEKLRRRSI
Subcellular Location(s) mito 14.5, mito_nucl 12.666, nucl 9.5, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007980  Ribosomal_VAR1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05316  VAR1  
Amino Acid Sequences MLNIIKSKLNTSYKKKRSNNKNVTISYKNFVPAIRDWKNSIYVYNKNTLSLIPVASNYIMKLIKGYFSLSNLKLEKKLRKEKLRRRSIKLSTNKIFLSDGEFKHTNDKVIITLYLYNRQKYNYLYKLKKRYVRLFVKTRFLEKLNLIKSKGLIILEKQRSLSQELKKILPSYKSKLSFFQHLYYKNFIKKALKRLKFYMFYKQLLYINQNKFNYSYLQGLINLIKKIFNKNVELNLINLKYFYFNSDIFSQPLVLKLRQKRNLLRYLKACVRKVKIKKTNETLNSYFFDLNKFNSVEHANILNNLFNEKYVNRFNSLLLNLLKQNEKIYSNNTAVKNKYDFNILKYIIFNNIKYKRVSGVRLEAAGRLTKRYTASRSRYKVIYKGNLENTLSSVKGDSSVVLRGNFKPNLQYTKLNSKSRIGSFGVKGWVSGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.87
4 0.89
5 0.91
6 0.92
7 0.91
8 0.91
9 0.86
10 0.84
11 0.81
12 0.74
13 0.66
14 0.58
15 0.49
16 0.41
17 0.37
18 0.34
19 0.32
20 0.38
21 0.41
22 0.41
23 0.42
24 0.44
25 0.48
26 0.44
27 0.43
28 0.4
29 0.42
30 0.43
31 0.47
32 0.44
33 0.39
34 0.39
35 0.34
36 0.31
37 0.25
38 0.22
39 0.15
40 0.15
41 0.16
42 0.16
43 0.17
44 0.13
45 0.16
46 0.15
47 0.14
48 0.16
49 0.15
50 0.16
51 0.16
52 0.19
53 0.16
54 0.19
55 0.26
56 0.25
57 0.31
58 0.32
59 0.34
60 0.38
61 0.44
62 0.49
63 0.53
64 0.62
65 0.65
66 0.74
67 0.82
68 0.86
69 0.89
70 0.92
71 0.9
72 0.88
73 0.89
74 0.87
75 0.85
76 0.85
77 0.84
78 0.77
79 0.73
80 0.65
81 0.56
82 0.48
83 0.38
84 0.35
85 0.32
86 0.28
87 0.3
88 0.31
89 0.3
90 0.37
91 0.37
92 0.32
93 0.26
94 0.26
95 0.2
96 0.2
97 0.19
98 0.14
99 0.17
100 0.18
101 0.25
102 0.27
103 0.29
104 0.29
105 0.3
106 0.31
107 0.31
108 0.39
109 0.39
110 0.46
111 0.52
112 0.6
113 0.69
114 0.74
115 0.76
116 0.76
117 0.76
118 0.76
119 0.77
120 0.76
121 0.76
122 0.73
123 0.75
124 0.69
125 0.63
126 0.56
127 0.49
128 0.44
129 0.38
130 0.41
131 0.38
132 0.4
133 0.37
134 0.35
135 0.33
136 0.31
137 0.29
138 0.22
139 0.17
140 0.16
141 0.25
142 0.27
143 0.28
144 0.27
145 0.27
146 0.27
147 0.31
148 0.35
149 0.31
150 0.35
151 0.36
152 0.37
153 0.38
154 0.39
155 0.37
156 0.36
157 0.36
158 0.34
159 0.4
160 0.42
161 0.41
162 0.44
163 0.43
164 0.44
165 0.41
166 0.41
167 0.38
168 0.39
169 0.41
170 0.4
171 0.41
172 0.38
173 0.37
174 0.36
175 0.39
176 0.4
177 0.47
178 0.53
179 0.55
180 0.55
181 0.58
182 0.62
183 0.59
184 0.56
185 0.56
186 0.5
187 0.46
188 0.43
189 0.4
190 0.35
191 0.31
192 0.33
193 0.31
194 0.31
195 0.35
196 0.35
197 0.33
198 0.31
199 0.31
200 0.28
201 0.21
202 0.18
203 0.13
204 0.13
205 0.13
206 0.13
207 0.14
208 0.15
209 0.13
210 0.12
211 0.14
212 0.14
213 0.18
214 0.21
215 0.22
216 0.23
217 0.25
218 0.28
219 0.28
220 0.27
221 0.24
222 0.24
223 0.22
224 0.18
225 0.15
226 0.13
227 0.11
228 0.11
229 0.12
230 0.1
231 0.1
232 0.13
233 0.15
234 0.16
235 0.16
236 0.16
237 0.15
238 0.12
239 0.16
240 0.17
241 0.17
242 0.23
243 0.3
244 0.4
245 0.46
246 0.53
247 0.56
248 0.61
249 0.69
250 0.66
251 0.64
252 0.58
253 0.57
254 0.58
255 0.58
256 0.54
257 0.51
258 0.52
259 0.56
260 0.61
261 0.65
262 0.67
263 0.68
264 0.72
265 0.72
266 0.76
267 0.72
268 0.71
269 0.62
270 0.57
271 0.5
272 0.44
273 0.38
274 0.29
275 0.26
276 0.2
277 0.19
278 0.19
279 0.18
280 0.16
281 0.18
282 0.19
283 0.16
284 0.17
285 0.18
286 0.14
287 0.16
288 0.16
289 0.15
290 0.14
291 0.14
292 0.13
293 0.11
294 0.13
295 0.12
296 0.16
297 0.2
298 0.22
299 0.23
300 0.24
301 0.25
302 0.27
303 0.28
304 0.27
305 0.23
306 0.23
307 0.22
308 0.24
309 0.25
310 0.21
311 0.22
312 0.21
313 0.22
314 0.22
315 0.24
316 0.28
317 0.3
318 0.36
319 0.39
320 0.41
321 0.4
322 0.43
323 0.42
324 0.38
325 0.35
326 0.37
327 0.34
328 0.32
329 0.38
330 0.34
331 0.33
332 0.32
333 0.32
334 0.32
335 0.33
336 0.31
337 0.33
338 0.37
339 0.39
340 0.39
341 0.4
342 0.38
343 0.41
344 0.44
345 0.41
346 0.43
347 0.42
348 0.43
349 0.42
350 0.37
351 0.34
352 0.34
353 0.29
354 0.25
355 0.23
356 0.24
357 0.27
358 0.32
359 0.37
360 0.42
361 0.51
362 0.58
363 0.63
364 0.64
365 0.67
366 0.66
367 0.66
368 0.65
369 0.65
370 0.61
371 0.64
372 0.65
373 0.64
374 0.6
375 0.53
376 0.46
377 0.39
378 0.33
379 0.25
380 0.2
381 0.14
382 0.15
383 0.14
384 0.12
385 0.12
386 0.16
387 0.19
388 0.2
389 0.24
390 0.27
391 0.34
392 0.36
393 0.35
394 0.38
395 0.42
396 0.47
397 0.48
398 0.51
399 0.5
400 0.59
401 0.67
402 0.66
403 0.64
404 0.62
405 0.65
406 0.61
407 0.6
408 0.53
409 0.51
410 0.47
411 0.48
412 0.47
413 0.39