Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0S7E9

Protein Details
Accession A0A2I0S7E9    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
4-24AQAQRMASKQQKKEVQKRGNAHydrophilic
86-109ERELEKERKRIRKVRERRVDKEEABasic
NLS Segment(s)
PositionSequence
59-62ERRG
68-70KER
84-113RLERELEKERKRIRKVRERRVDKEEAHKLK
Subcellular Location(s) nucl 13, cyto 8, mito 5
Family & Domain DBs
Amino Acid Sequences MGTAQAQRMASKQQKKEVQKRGNAIAKQPGKSSQKAAVRLAELEALLEKERGKLQARLERRGDGASEKERERIFREFEKEEEERLERELEKERKRIRKVRERRVDKEEAHKLKKDQEEEATQKVRWIVITKWIGEKEEDEGEEGLVVGDDANANGNGRGEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.72
3 0.8
4 0.81
5 0.81
6 0.8
7 0.79
8 0.79
9 0.79
10 0.7
11 0.65
12 0.64
13 0.61
14 0.55
15 0.51
16 0.5
17 0.47
18 0.47
19 0.46
20 0.44
21 0.44
22 0.47
23 0.47
24 0.42
25 0.38
26 0.35
27 0.32
28 0.25
29 0.18
30 0.14
31 0.12
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.11
38 0.15
39 0.17
40 0.21
41 0.27
42 0.34
43 0.39
44 0.44
45 0.45
46 0.42
47 0.41
48 0.37
49 0.31
50 0.25
51 0.25
52 0.23
53 0.24
54 0.23
55 0.26
56 0.26
57 0.27
58 0.28
59 0.27
60 0.26
61 0.27
62 0.31
63 0.29
64 0.29
65 0.32
66 0.29
67 0.26
68 0.25
69 0.21
70 0.17
71 0.16
72 0.17
73 0.12
74 0.14
75 0.22
76 0.28
77 0.31
78 0.39
79 0.46
80 0.54
81 0.61
82 0.67
83 0.68
84 0.71
85 0.77
86 0.8
87 0.83
88 0.83
89 0.81
90 0.81
91 0.78
92 0.71
93 0.7
94 0.69
95 0.66
96 0.63
97 0.6
98 0.55
99 0.55
100 0.58
101 0.51
102 0.45
103 0.41
104 0.44
105 0.44
106 0.49
107 0.44
108 0.38
109 0.37
110 0.34
111 0.29
112 0.23
113 0.22
114 0.17
115 0.23
116 0.27
117 0.26
118 0.31
119 0.32
120 0.31
121 0.29
122 0.29
123 0.24
124 0.23
125 0.22
126 0.19
127 0.18
128 0.16
129 0.15
130 0.14
131 0.1
132 0.06
133 0.06
134 0.04
135 0.04
136 0.04
137 0.04
138 0.06
139 0.07
140 0.08
141 0.09