Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0RR62

Protein Details
Accession A0A2I0RR62    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAIRQDRPRRRAKSRHPVVARIHydrophilic
NLS Segment(s)
PositionSequence
8-15PRRRAKSR
Subcellular Location(s) mito 20, nucl 6, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MAIRQDRPRRRAKSRHPVVARILRNLELASGDHEAHGRMVSRLMSYRDTPASTARDVLSQPADPPPPPPPLSPAPPPVGACDDACG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.83
4 0.79
5 0.78
6 0.76
7 0.68
8 0.61
9 0.54
10 0.44
11 0.4
12 0.34
13 0.26
14 0.17
15 0.15
16 0.12
17 0.12
18 0.11
19 0.1
20 0.1
21 0.1
22 0.1
23 0.1
24 0.08
25 0.06
26 0.07
27 0.07
28 0.08
29 0.1
30 0.11
31 0.13
32 0.13
33 0.15
34 0.16
35 0.16
36 0.16
37 0.18
38 0.19
39 0.17
40 0.18
41 0.15
42 0.16
43 0.16
44 0.17
45 0.16
46 0.14
47 0.14
48 0.17
49 0.19
50 0.17
51 0.2
52 0.22
53 0.25
54 0.27
55 0.27
56 0.29
57 0.33
58 0.38
59 0.41
60 0.42
61 0.4
62 0.41
63 0.41
64 0.39
65 0.37
66 0.33