Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MNA3

Protein Details
Accession B8MNA3   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
41-68DSLAVAVSKRRKKHKKKSAKSVSESPGLHydrophilic
NLS Segment(s)
PositionSequence
48-60SKRRKKHKKKSAK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSFSMKRDVQREVPRTSSGTFAVPGPVSRERLEEHVKRASDSLAVAVSKRRKKHKKKSAKSVSESPGLASEGSSDHGSNSDAVSPSKSRLEVPVLKTKAGTIRPLGDVRSVPCYECIRSITNDSFIKYPHRCYDVKHETRIGVNSQCSTCARKHVSPCLPIPAEFAKDSDAIYAAFELEGHTDSVRGSALALLERMPAEPAGKKNRVIKSESEPIASPSPSFELSRVSEADYDSVLHFRRGVKDLAVPNDLRLSIRKIVSDWIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.48
4 0.42
5 0.33
6 0.28
7 0.24
8 0.21
9 0.21
10 0.19
11 0.19
12 0.21
13 0.24
14 0.25
15 0.25
16 0.27
17 0.25
18 0.31
19 0.4
20 0.39
21 0.4
22 0.44
23 0.44
24 0.42
25 0.41
26 0.36
27 0.28
28 0.24
29 0.19
30 0.15
31 0.14
32 0.14
33 0.2
34 0.28
35 0.33
36 0.4
37 0.49
38 0.58
39 0.69
40 0.8
41 0.84
42 0.86
43 0.91
44 0.95
45 0.95
46 0.94
47 0.9
48 0.87
49 0.81
50 0.74
51 0.63
52 0.52
53 0.42
54 0.33
55 0.26
56 0.17
57 0.13
58 0.09
59 0.1
60 0.1
61 0.09
62 0.08
63 0.09
64 0.1
65 0.09
66 0.09
67 0.1
68 0.1
69 0.11
70 0.13
71 0.14
72 0.15
73 0.17
74 0.17
75 0.15
76 0.17
77 0.23
78 0.27
79 0.3
80 0.38
81 0.37
82 0.36
83 0.36
84 0.34
85 0.33
86 0.29
87 0.27
88 0.19
89 0.2
90 0.23
91 0.24
92 0.23
93 0.2
94 0.19
95 0.17
96 0.21
97 0.18
98 0.16
99 0.19
100 0.2
101 0.19
102 0.19
103 0.21
104 0.17
105 0.18
106 0.22
107 0.19
108 0.22
109 0.23
110 0.22
111 0.2
112 0.19
113 0.24
114 0.22
115 0.24
116 0.23
117 0.26
118 0.25
119 0.27
120 0.37
121 0.41
122 0.43
123 0.42
124 0.41
125 0.37
126 0.38
127 0.38
128 0.29
129 0.21
130 0.19
131 0.18
132 0.17
133 0.17
134 0.17
135 0.18
136 0.17
137 0.21
138 0.25
139 0.28
140 0.32
141 0.39
142 0.43
143 0.44
144 0.45
145 0.44
146 0.4
147 0.35
148 0.34
149 0.27
150 0.24
151 0.2
152 0.2
153 0.15
154 0.14
155 0.14
156 0.11
157 0.1
158 0.07
159 0.07
160 0.07
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.07
173 0.06
174 0.05
175 0.06
176 0.06
177 0.07
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.13
187 0.19
188 0.27
189 0.3
190 0.35
191 0.42
192 0.48
193 0.51
194 0.5
195 0.49
196 0.47
197 0.53
198 0.5
199 0.44
200 0.38
201 0.38
202 0.38
203 0.34
204 0.26
205 0.19
206 0.2
207 0.19
208 0.2
209 0.17
210 0.18
211 0.2
212 0.23
213 0.22
214 0.21
215 0.2
216 0.2
217 0.21
218 0.16
219 0.15
220 0.13
221 0.17
222 0.16
223 0.16
224 0.18
225 0.2
226 0.25
227 0.27
228 0.28
229 0.26
230 0.32
231 0.37
232 0.4
233 0.41
234 0.36
235 0.35
236 0.36
237 0.34
238 0.29
239 0.26
240 0.27
241 0.28
242 0.29
243 0.29
244 0.27