Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0S931

Protein Details
Accession A0A2I0S931    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
125-148SNSLSRFSWRKSKRKSMKMADGPEHydrophilic
NLS Segment(s)
PositionSequence
111-124PKTPKTPKSLKMRT
128-140LSRFSWRKSKRKS
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001711  PLipase_C_Pinositol-sp_Y  
Gene Ontology GO:0004435  F:phosphatidylinositol phospholipase C activity  
GO:0035556  P:intracellular signal transduction  
GO:0006629  P:lipid metabolic process  
PROSITE View protein in PROSITE  
PS50008  PIPLC_Y_DOMAIN  
Amino Acid Sequences MCCHSRIIYATCGHSTFCPRPLLECRDASFDPSAPWSTGCEIVAHPYKTLRLDQLCPQCIVTRDSLLKEIEEKQAVKFDEWQWKVSYSMPSGGKDYWEKKAEEKMEPPEAPKTPKTPKSLKMRTSNSLSRFSWRKSKRKSMKMADGPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.3
4 0.32
5 0.33
6 0.31
7 0.36
8 0.42
9 0.47
10 0.45
11 0.44
12 0.42
13 0.44
14 0.44
15 0.41
16 0.35
17 0.28
18 0.24
19 0.23
20 0.23
21 0.17
22 0.17
23 0.16
24 0.15
25 0.16
26 0.15
27 0.14
28 0.12
29 0.17
30 0.23
31 0.21
32 0.2
33 0.2
34 0.21
35 0.22
36 0.24
37 0.23
38 0.2
39 0.23
40 0.3
41 0.36
42 0.36
43 0.35
44 0.34
45 0.3
46 0.29
47 0.28
48 0.22
49 0.17
50 0.17
51 0.17
52 0.19
53 0.17
54 0.16
55 0.16
56 0.17
57 0.16
58 0.17
59 0.16
60 0.14
61 0.18
62 0.19
63 0.17
64 0.18
65 0.19
66 0.27
67 0.28
68 0.29
69 0.26
70 0.26
71 0.26
72 0.26
73 0.25
74 0.16
75 0.21
76 0.21
77 0.21
78 0.22
79 0.21
80 0.21
81 0.24
82 0.26
83 0.27
84 0.28
85 0.29
86 0.29
87 0.37
88 0.38
89 0.37
90 0.38
91 0.37
92 0.41
93 0.41
94 0.4
95 0.39
96 0.38
97 0.39
98 0.37
99 0.39
100 0.42
101 0.48
102 0.53
103 0.55
104 0.6
105 0.66
106 0.72
107 0.73
108 0.74
109 0.73
110 0.72
111 0.73
112 0.72
113 0.65
114 0.63
115 0.56
116 0.54
117 0.54
118 0.52
119 0.55
120 0.57
121 0.63
122 0.66
123 0.76
124 0.79
125 0.83
126 0.89
127 0.89
128 0.9