Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0SA95

Protein Details
Accession A0A2I0SA95   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
259-286ATQFLAAEMKKRRYRKKPTEVVQPEQIQHydrophilic
NLS Segment(s)
PositionSequence
268-275KKRRYRKK
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MYRANGATKPKVLCVRTKRPTAPPSEAGSDTSEKIVVPEDHNPFFQEGPAAEVEPQEDSYSFTPRQWAAMQEYVPERRQRAPTSASWTSVVGYKKKQEGSVFHNEDEHDEDGSTTDQDASEGEEAAARDKVSDGEDDDTDGDVTISRDEDEHGNDPSELESEDEEDGQYEMSESNDSFLTEEYRGRIYINANQRNKARKLNEIKAASGKYAEDYLDRKMHPRWTTYQSKGHAMPETAWHLRTIDALADLAAICPNSDKATQFLAAEMKKRRYRKKPTEVVQPEQIQRVCRKLRDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.64
4 0.72
5 0.71
6 0.73
7 0.77
8 0.76
9 0.73
10 0.68
11 0.65
12 0.6
13 0.55
14 0.47
15 0.44
16 0.38
17 0.32
18 0.27
19 0.22
20 0.17
21 0.17
22 0.19
23 0.18
24 0.18
25 0.25
26 0.3
27 0.31
28 0.32
29 0.33
30 0.3
31 0.27
32 0.25
33 0.19
34 0.13
35 0.14
36 0.15
37 0.14
38 0.13
39 0.12
40 0.13
41 0.12
42 0.12
43 0.1
44 0.1
45 0.12
46 0.13
47 0.18
48 0.18
49 0.17
50 0.21
51 0.2
52 0.24
53 0.22
54 0.24
55 0.24
56 0.27
57 0.27
58 0.26
59 0.3
60 0.31
61 0.34
62 0.34
63 0.32
64 0.33
65 0.39
66 0.39
67 0.4
68 0.41
69 0.41
70 0.46
71 0.45
72 0.41
73 0.35
74 0.32
75 0.28
76 0.28
77 0.27
78 0.22
79 0.24
80 0.27
81 0.31
82 0.33
83 0.36
84 0.35
85 0.37
86 0.4
87 0.47
88 0.45
89 0.4
90 0.4
91 0.36
92 0.33
93 0.32
94 0.26
95 0.15
96 0.12
97 0.12
98 0.11
99 0.11
100 0.1
101 0.07
102 0.06
103 0.05
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.09
114 0.07
115 0.07
116 0.07
117 0.08
118 0.07
119 0.08
120 0.08
121 0.09
122 0.09
123 0.1
124 0.1
125 0.09
126 0.08
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.04
134 0.05
135 0.06
136 0.07
137 0.09
138 0.1
139 0.1
140 0.11
141 0.11
142 0.11
143 0.1
144 0.09
145 0.07
146 0.06
147 0.06
148 0.06
149 0.07
150 0.07
151 0.06
152 0.06
153 0.06
154 0.05
155 0.05
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.06
164 0.06
165 0.07
166 0.08
167 0.09
168 0.1
169 0.1
170 0.11
171 0.11
172 0.11
173 0.13
174 0.13
175 0.19
176 0.28
177 0.36
178 0.38
179 0.42
180 0.47
181 0.53
182 0.54
183 0.56
184 0.49
185 0.5
186 0.56
187 0.59
188 0.62
189 0.57
190 0.55
191 0.51
192 0.49
193 0.4
194 0.32
195 0.25
196 0.17
197 0.16
198 0.15
199 0.12
200 0.13
201 0.17
202 0.21
203 0.21
204 0.23
205 0.26
206 0.34
207 0.34
208 0.37
209 0.39
210 0.42
211 0.5
212 0.53
213 0.56
214 0.52
215 0.54
216 0.52
217 0.5
218 0.45
219 0.37
220 0.32
221 0.3
222 0.33
223 0.3
224 0.28
225 0.25
226 0.22
227 0.21
228 0.21
229 0.17
230 0.11
231 0.1
232 0.09
233 0.08
234 0.08
235 0.08
236 0.07
237 0.07
238 0.06
239 0.06
240 0.07
241 0.08
242 0.1
243 0.12
244 0.13
245 0.15
246 0.18
247 0.19
248 0.18
249 0.2
250 0.24
251 0.25
252 0.31
253 0.36
254 0.43
255 0.49
256 0.59
257 0.67
258 0.71
259 0.8
260 0.84
261 0.88
262 0.89
263 0.89
264 0.91
265 0.88
266 0.84
267 0.82
268 0.78
269 0.7
270 0.67
271 0.62
272 0.56
273 0.53
274 0.56
275 0.54