Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0S9H5

Protein Details
Accession A0A2I0S9H5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-84ARQRLIEKRKRRAEREGQNLGBasic
NLS Segment(s)
PositionSequence
71-75KRKRR
Subcellular Location(s) mito 11.5, cyto_mito 9, nucl 7, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVNKILFWSSFGIAVRFWQLGIEMRPFFQRENWLIYPIYGGLGASFGYWLQGVDERQMRYLGDARQRLIEKRKRRAEREGQNLGSDFQKHQAGAHASVEERGAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.14
4 0.13
5 0.1
6 0.11
7 0.14
8 0.16
9 0.2
10 0.17
11 0.18
12 0.21
13 0.22
14 0.22
15 0.21
16 0.25
17 0.22
18 0.29
19 0.29
20 0.29
21 0.28
22 0.27
23 0.25
24 0.18
25 0.16
26 0.08
27 0.07
28 0.04
29 0.05
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.04
36 0.03
37 0.04
38 0.06
39 0.06
40 0.09
41 0.12
42 0.12
43 0.13
44 0.14
45 0.13
46 0.13
47 0.17
48 0.18
49 0.22
50 0.24
51 0.24
52 0.28
53 0.3
54 0.33
55 0.4
56 0.45
57 0.47
58 0.56
59 0.65
60 0.69
61 0.73
62 0.79
63 0.79
64 0.8
65 0.8
66 0.79
67 0.7
68 0.63
69 0.58
70 0.49
71 0.41
72 0.33
73 0.25
74 0.2
75 0.21
76 0.19
77 0.19
78 0.24
79 0.26
80 0.26
81 0.27
82 0.25
83 0.23
84 0.23
85 0.23