Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0S7M8

Protein Details
Accession A0A2I0S7M8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
21-46VEPQEKKKVPKGRAKKRIQYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKVPKGRAKKR
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKVPKGRAKKRIQYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.46
5 0.48
6 0.57
7 0.59
8 0.65
9 0.64
10 0.66
11 0.69
12 0.7
13 0.72
14 0.71
15 0.72
16 0.69
17 0.73
18 0.75
19 0.75
20 0.79
21 0.81
22 0.81
23 0.83
24 0.86
25 0.85
26 0.84
27 0.81
28 0.8
29 0.77
30 0.7
31 0.61
32 0.58
33 0.52
34 0.45
35 0.44
36 0.37
37 0.36
38 0.36
39 0.38
40 0.37
41 0.42
42 0.48