Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0S0X6

Protein Details
Accession A0A2I0S0X6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-106VKDSKIAKPSQKSKGSKKCAKKNVVHydrophilic
NLS Segment(s)
PositionSequence
28-103KTKKQEPQGKKGAQANKGDKQSKGSKQSKAAKESKAAKESKAAKESKAAKESNAVKDSKIAKPSQKSKGSKKCAKK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MYARFETPEPARRWGEFITEWELLNPPKTKKQEPQGKKGAQANKGDKQSKGSKQSKAAKESKAAKESKAAKESKAAKESNAVKDSKIAKPSQKSKGSKKCAKKNVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.31
4 0.3
5 0.3
6 0.28
7 0.27
8 0.24
9 0.25
10 0.21
11 0.25
12 0.26
13 0.23
14 0.3
15 0.36
16 0.41
17 0.46
18 0.56
19 0.62
20 0.64
21 0.7
22 0.72
23 0.68
24 0.68
25 0.67
26 0.63
27 0.58
28 0.59
29 0.57
30 0.53
31 0.57
32 0.54
33 0.48
34 0.47
35 0.49
36 0.47
37 0.51
38 0.5
39 0.47
40 0.53
41 0.62
42 0.62
43 0.62
44 0.61
45 0.53
46 0.54
47 0.58
48 0.55
49 0.53
50 0.49
51 0.42
52 0.44
53 0.49
54 0.48
55 0.46
56 0.42
57 0.35
58 0.42
59 0.48
60 0.46
61 0.46
62 0.4
63 0.34
64 0.41
65 0.46
66 0.47
67 0.44
68 0.39
69 0.33
70 0.39
71 0.43
72 0.4
73 0.4
74 0.37
75 0.41
76 0.5
77 0.58
78 0.62
79 0.67
80 0.7
81 0.76
82 0.81
83 0.84
84 0.84
85 0.87
86 0.88