Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0RZR5

Protein Details
Accession A0A2I0RZR5   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-29VISTPSRPNPQSRKPRKYHRAYDDRAEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVISTPSRPNPQSRKPRKYHRAYDDRAEVEFGHAMEFNDPNSLKTADQCDGKDQLWSWGHLEVADVRSLCSFVVRSKKAAPDAQCTPFRSLSRMRAGLWICVGLSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.89
4 0.9
5 0.91
6 0.91
7 0.9
8 0.89
9 0.84
10 0.82
11 0.78
12 0.69
13 0.59
14 0.5
15 0.39
16 0.3
17 0.26
18 0.18
19 0.12
20 0.11
21 0.1
22 0.11
23 0.11
24 0.09
25 0.12
26 0.12
27 0.12
28 0.13
29 0.14
30 0.13
31 0.14
32 0.17
33 0.16
34 0.19
35 0.19
36 0.19
37 0.2
38 0.2
39 0.19
40 0.16
41 0.19
42 0.17
43 0.18
44 0.16
45 0.14
46 0.14
47 0.13
48 0.14
49 0.09
50 0.09
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.08
59 0.11
60 0.21
61 0.22
62 0.25
63 0.29
64 0.33
65 0.37
66 0.42
67 0.41
68 0.39
69 0.43
70 0.47
71 0.49
72 0.47
73 0.46
74 0.46
75 0.44
76 0.42
77 0.42
78 0.43
79 0.46
80 0.46
81 0.42
82 0.44
83 0.44
84 0.42
85 0.38
86 0.31