Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0RN53

Protein Details
Accession A0A2I0RN53    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MPKRRRGYGDYPTRHKQKKPKRRRGTAGTDVAABasic
NLS Segment(s)
PositionSequence
4-25RRRGYGDYPTRHKQKKPKRRRG
Subcellular Location(s) mito 11.5, nucl 10, cyto_mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
Amino Acid Sequences MPKRRRGYGDYPTRHKQKKPKRRRGTAGTDVAAIPELMEMILLDLPLKQVVAVQRVSKDFRDAIQISYKLQKVLFLRPIDATKERLVIPQTLRCYPNAPNPNETPREAVLNPFVAELHFPWLDLIQLLRVRKRKSVHKPIYRILYRTADPNLSSCDETSLSKMQVFRPPVSEIWLRCPKVLIAEDAKGETLEPHWHSIRAREGQTGVTVGDIKEHADRFGGKCELILPYGTKRLFEELTPGWYTECGNKRARWAYKLLKPNKEHVADRPPRAIPVVPVQGMAPRSRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.81
4 0.82
5 0.84
6 0.87
7 0.89
8 0.9
9 0.93
10 0.95
11 0.93
12 0.92
13 0.9
14 0.87
15 0.76
16 0.67
17 0.56
18 0.46
19 0.36
20 0.26
21 0.16
22 0.08
23 0.07
24 0.05
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.05
36 0.08
37 0.11
38 0.15
39 0.18
40 0.2
41 0.23
42 0.27
43 0.31
44 0.29
45 0.29
46 0.26
47 0.25
48 0.31
49 0.28
50 0.27
51 0.31
52 0.31
53 0.29
54 0.34
55 0.35
56 0.28
57 0.27
58 0.29
59 0.24
60 0.31
61 0.35
62 0.3
63 0.31
64 0.31
65 0.34
66 0.34
67 0.33
68 0.29
69 0.23
70 0.25
71 0.23
72 0.24
73 0.24
74 0.24
75 0.25
76 0.28
77 0.3
78 0.32
79 0.32
80 0.3
81 0.31
82 0.3
83 0.36
84 0.39
85 0.38
86 0.38
87 0.41
88 0.46
89 0.46
90 0.44
91 0.37
92 0.29
93 0.31
94 0.26
95 0.24
96 0.2
97 0.18
98 0.17
99 0.14
100 0.13
101 0.09
102 0.1
103 0.08
104 0.1
105 0.09
106 0.08
107 0.09
108 0.09
109 0.08
110 0.08
111 0.08
112 0.07
113 0.1
114 0.11
115 0.17
116 0.22
117 0.24
118 0.3
119 0.35
120 0.42
121 0.5
122 0.6
123 0.65
124 0.68
125 0.71
126 0.7
127 0.75
128 0.66
129 0.57
130 0.49
131 0.42
132 0.34
133 0.31
134 0.28
135 0.2
136 0.19
137 0.18
138 0.17
139 0.15
140 0.15
141 0.12
142 0.12
143 0.12
144 0.12
145 0.14
146 0.13
147 0.13
148 0.14
149 0.16
150 0.17
151 0.21
152 0.24
153 0.22
154 0.23
155 0.25
156 0.23
157 0.26
158 0.27
159 0.22
160 0.28
161 0.35
162 0.33
163 0.3
164 0.31
165 0.27
166 0.28
167 0.28
168 0.23
169 0.18
170 0.19
171 0.19
172 0.19
173 0.19
174 0.14
175 0.13
176 0.1
177 0.08
178 0.12
179 0.13
180 0.16
181 0.17
182 0.19
183 0.2
184 0.24
185 0.29
186 0.3
187 0.3
188 0.28
189 0.28
190 0.27
191 0.27
192 0.24
193 0.16
194 0.12
195 0.11
196 0.09
197 0.09
198 0.09
199 0.1
200 0.13
201 0.13
202 0.13
203 0.13
204 0.16
205 0.16
206 0.22
207 0.22
208 0.18
209 0.18
210 0.19
211 0.19
212 0.17
213 0.17
214 0.13
215 0.15
216 0.23
217 0.23
218 0.22
219 0.22
220 0.25
221 0.25
222 0.23
223 0.26
224 0.2
225 0.25
226 0.25
227 0.24
228 0.2
229 0.2
230 0.21
231 0.23
232 0.28
233 0.29
234 0.34
235 0.36
236 0.43
237 0.52
238 0.57
239 0.53
240 0.56
241 0.59
242 0.62
243 0.7
244 0.71
245 0.71
246 0.69
247 0.72
248 0.72
249 0.69
250 0.63
251 0.61
252 0.63
253 0.61
254 0.63
255 0.62
256 0.54
257 0.5
258 0.5
259 0.44
260 0.37
261 0.37
262 0.39
263 0.33
264 0.32
265 0.31
266 0.32
267 0.33
268 0.3