Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0RVE9

Protein Details
Accession A0A2I0RVE9    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGLLRSPSKLLKKKKKTEGDAEKPEGEHydrophilic
NLS Segment(s)
PositionSequence
10-16LLKKKKK
117-146GNRKVVKKQEREEEKLKKLAEKMKKAEEEK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MGLLRSPSKLLKKKKKTEGDAEKPEGEEAASLPPAPSTTELTLRGEREKSQTAYERAQKAEAAYRAKKQAERARVDYKNSKGHLKTSCVEFKKGLQTAFSSARSSPAVLKERQHNAGNRKVVKKQEREEEKLKKLAEKMKKAEEEKAKLDAAAPPAEEAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.87
4 0.89
5 0.89
6 0.88
7 0.87
8 0.81
9 0.72
10 0.62
11 0.54
12 0.43
13 0.32
14 0.22
15 0.13
16 0.11
17 0.1
18 0.09
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.12
25 0.14
26 0.17
27 0.19
28 0.23
29 0.26
30 0.26
31 0.28
32 0.26
33 0.26
34 0.28
35 0.31
36 0.29
37 0.3
38 0.35
39 0.35
40 0.39
41 0.44
42 0.42
43 0.38
44 0.38
45 0.33
46 0.28
47 0.3
48 0.28
49 0.28
50 0.27
51 0.29
52 0.34
53 0.36
54 0.37
55 0.4
56 0.42
57 0.44
58 0.47
59 0.49
60 0.53
61 0.53
62 0.56
63 0.54
64 0.51
65 0.49
66 0.45
67 0.45
68 0.37
69 0.4
70 0.39
71 0.36
72 0.34
73 0.32
74 0.38
75 0.35
76 0.36
77 0.31
78 0.3
79 0.34
80 0.34
81 0.29
82 0.22
83 0.22
84 0.24
85 0.27
86 0.25
87 0.19
88 0.17
89 0.19
90 0.19
91 0.19
92 0.17
93 0.2
94 0.24
95 0.25
96 0.29
97 0.34
98 0.38
99 0.43
100 0.45
101 0.45
102 0.46
103 0.52
104 0.56
105 0.55
106 0.55
107 0.56
108 0.61
109 0.64
110 0.66
111 0.65
112 0.67
113 0.69
114 0.71
115 0.75
116 0.75
117 0.72
118 0.69
119 0.63
120 0.58
121 0.56
122 0.58
123 0.58
124 0.58
125 0.59
126 0.62
127 0.68
128 0.67
129 0.69
130 0.69
131 0.66
132 0.6
133 0.57
134 0.49
135 0.41
136 0.39
137 0.34
138 0.29
139 0.24
140 0.21
141 0.18
142 0.18