FuNGI

A0A2I0S904

Protein Details

Accession

A0A2I0S904

Localization Confidence

Medium

Confidence Score

11.7

NoLS Segment(s)

Position	Sequence	Protein Nature
140-161	GDVRHKTAEKIRKQRRRNGEGE	Basic

NLS Segment(s)

Position	Sequence
143-156	RHKTAEKIRKQRRR

Subcellular Location(s)

cyto 11, nucl 10, mito 3, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR021056 Mt_import_IM_translocase_Tim54
Gene Ontology	GO:0005743 C:mitochondrial inner membrane
Pfam	View protein in Pfam PF11711 Tim54

Amino Acid Sequences

MVEQANSPNNGPAAAAADGAGKTAKATAQNPAFRMMGLPRLRLPSRNWTIFWTITGSFAGAVIYDKYQTKRTREKWTSLVSHIAEERLDTKTIPRRVTIYLQAPPGDGLRAAREHFHLYVKPILVAAAMDWDVIEGRKEGDVRHKTAEKIRKQRRRNGEGEPVTDDEDGNLIVATLRRQNGDVEYPGVAGDIVIGRHTWKEYIRGLHEGYLGPANLPKDDESDSSPAAGTASHESGSTPADEAAANEMSDNGAGAVGSSPLTSLDTVVGDAAAGHSPDAVNVGGGPNEEQKAQESAESKENGGEQKPKRRFPPSPILPEDYNTAALSPSMPEILGPSVGVRLPHLLGIKNTPVRIYRFLTRRRLQDDIGRQVAAAVMASYRPYTTAASQGDSSTTTDAGQELPEQAMVLQHEEKDWYKLVHKSRAEHEESLWIEPIALDERIASRMRTFELSSADEERSRRIAEGKEPTSNQEG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.12
3	0.1
4	0.12
5	0.12
6	0.12
7	0.12
8	0.08
9	0.08
10	0.1
11	0.12
12	0.16
13	0.18
14	0.26
15	0.34
16	0.4
17	0.41
18	0.43
19	0.4
20	0.34
21	0.35
22	0.29
23	0.3
24	0.28
25	0.3
26	0.3
27	0.37
28	0.39
29	0.41
30	0.44
31	0.45
32	0.51
33	0.53
34	0.5
35	0.48
36	0.51
37	0.47
38	0.43
39	0.37
40	0.28
41	0.25
42	0.24
43	0.19
44	0.13
45	0.13
46	0.11
47	0.07
48	0.08
49	0.08
50	0.08
51	0.11
52	0.14
53	0.17
54	0.26
55	0.32
56	0.4
57	0.49
58	0.56
59	0.65
60	0.68
61	0.72
62	0.72
63	0.73
64	0.7
65	0.62
66	0.62
67	0.51
68	0.47
69	0.41
70	0.35
71	0.26
72	0.22
73	0.21
74	0.16
75	0.16
76	0.13
77	0.19
78	0.27
79	0.34
80	0.35
81	0.35
82	0.36
83	0.39
84	0.44
85	0.44
86	0.4
87	0.38
88	0.39
89	0.38
90	0.35
91	0.32
92	0.27
93	0.21
94	0.15
95	0.12
96	0.12
97	0.14
98	0.14
99	0.16
100	0.17
101	0.2
102	0.21
103	0.24
104	0.22
105	0.23
106	0.27
107	0.25
108	0.23
109	0.2
110	0.18
111	0.14
112	0.13
113	0.09
114	0.07
115	0.06
116	0.06
117	0.05
118	0.06
119	0.06
120	0.06
121	0.07
122	0.05
123	0.06
124	0.08
125	0.09
126	0.11
127	0.21
128	0.26
129	0.28
130	0.34
131	0.36
132	0.38
133	0.46
134	0.54
135	0.53
136	0.59
137	0.66
138	0.7
139	0.76
140	0.82
141	0.84
142	0.83
143	0.79
144	0.75
145	0.75
146	0.69
147	0.63
148	0.56
149	0.46
150	0.4
151	0.35
152	0.27
153	0.17
154	0.13
155	0.1
156	0.07
157	0.06
158	0.04
159	0.04
160	0.05
161	0.06
162	0.1
163	0.11
164	0.11
165	0.12
166	0.14
167	0.15
168	0.17
169	0.17
170	0.15
171	0.14
172	0.14
173	0.13
174	0.11
175	0.09
176	0.06
177	0.05
178	0.04
179	0.04
180	0.04
181	0.04
182	0.05
183	0.06
184	0.07
185	0.08
186	0.09
187	0.13
188	0.16
189	0.2
190	0.22
191	0.24
192	0.24
193	0.24
194	0.24
195	0.2
196	0.18
197	0.15
198	0.12
199	0.09
200	0.11
201	0.1
202	0.08
203	0.09
204	0.09
205	0.09
206	0.11
207	0.12
208	0.13
209	0.14
210	0.14
211	0.14
212	0.13
213	0.11
214	0.09
215	0.08
216	0.07
217	0.07
218	0.07
219	0.07
220	0.07
221	0.07
222	0.08
223	0.09
224	0.08
225	0.06
226	0.05
227	0.06
228	0.06
229	0.06
230	0.07
231	0.07
232	0.07
233	0.06
234	0.06
235	0.06
236	0.06
237	0.05
238	0.03
239	0.02
240	0.02
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.03
247	0.04
248	0.05
249	0.04
250	0.05
251	0.05
252	0.05
253	0.05
254	0.05
255	0.04
256	0.04
257	0.04
258	0.04
259	0.04
260	0.04
261	0.04
262	0.04
263	0.04
264	0.04
265	0.05
266	0.04
267	0.04
268	0.04
269	0.05
270	0.05
271	0.05
272	0.06
273	0.07
274	0.08
275	0.08
276	0.08
277	0.1
278	0.11
279	0.11
280	0.13
281	0.13
282	0.15
283	0.2
284	0.21
285	0.19
286	0.19
287	0.21
288	0.2
289	0.21
290	0.27
291	0.28
292	0.37
293	0.44
294	0.49
295	0.53
296	0.59
297	0.61
298	0.6
299	0.66
300	0.64
301	0.65
302	0.64
303	0.63
304	0.55
305	0.51
306	0.45
307	0.35
308	0.28
309	0.19
310	0.15
311	0.11
312	0.1
313	0.09
314	0.07
315	0.07
316	0.06
317	0.06
318	0.05
319	0.07
320	0.07
321	0.07
322	0.06
323	0.06
324	0.07
325	0.08
326	0.08
327	0.08
328	0.09
329	0.09
330	0.12
331	0.13
332	0.14
333	0.14
334	0.18
335	0.24
336	0.25
337	0.25
338	0.24
339	0.26
340	0.29
341	0.32
342	0.33
343	0.35
344	0.4
345	0.48
346	0.56
347	0.59
348	0.62
349	0.63
350	0.63
351	0.57
352	0.58
353	0.59
354	0.56
355	0.53
356	0.45
357	0.39
358	0.35
359	0.33
360	0.24
361	0.15
362	0.07
363	0.05
364	0.05
365	0.06
366	0.07
367	0.06
368	0.07
369	0.09
370	0.11
371	0.12
372	0.19
373	0.2
374	0.22
375	0.22
376	0.22
377	0.21
378	0.2
379	0.2
380	0.14
381	0.13
382	0.11
383	0.11
384	0.11
385	0.1
386	0.1
387	0.1
388	0.1
389	0.1
390	0.1
391	0.09
392	0.09
393	0.1
394	0.1
395	0.13
396	0.14
397	0.13
398	0.14
399	0.18
400	0.19
401	0.2
402	0.22
403	0.21
404	0.25
405	0.32
406	0.39
407	0.45
408	0.48
409	0.5
410	0.56
411	0.62
412	0.62
413	0.57
414	0.51
415	0.49
416	0.46
417	0.43
418	0.37
419	0.28
420	0.22
421	0.19
422	0.2
423	0.15
424	0.13
425	0.11
426	0.11
427	0.12
428	0.16
429	0.18
430	0.17
431	0.16
432	0.19
433	0.21
434	0.24
435	0.24
436	0.24
437	0.27
438	0.29
439	0.3
440	0.31
441	0.31
442	0.31
443	0.31
444	0.32
445	0.31
446	0.3
447	0.28
448	0.3
449	0.32
450	0.38
451	0.47
452	0.47
453	0.52
454	0.52

A0A2I0S904

3D AlphaFold-predicted Structure Viewer