Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0S9E7

Protein Details
Accession A0A2I0S9E7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 14.5, cyto_nucl 10, mito 8, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVIFDKNTTEKLNKDVQSYRLITVAVLVDRLKINGSLARQALKDLEERGVIKQVVGHSACKIYTREVGGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.77
12 0.68
13 0.58
14 0.54
15 0.45
16 0.41
17 0.34
18 0.26
19 0.21
20 0.21
21 0.22
22 0.19
23 0.19
24 0.19
25 0.26
26 0.26
27 0.29
28 0.3
29 0.3
30 0.33
31 0.34
32 0.3
33 0.23
34 0.22
35 0.17
36 0.15
37 0.13
38 0.08
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.11
49 0.13
50 0.14
51 0.16
52 0.16
53 0.16
54 0.16
55 0.15
56 0.16
57 0.14
58 0.15
59 0.15
60 0.16
61 0.17
62 0.21
63 0.19
64 0.17
65 0.18
66 0.18
67 0.22
68 0.22
69 0.22
70 0.19
71 0.21
72 0.22
73 0.23
74 0.23
75 0.21
76 0.24
77 0.26