Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0SA16

Protein Details
Accession A0A2I0SA16   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-40SKNRGSSRRDDDKQRSKHGSBasic
NLS Segment(s)
PositionSequence
33-45KQRSKHGSSRRPS
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038491  Velvet_dom_sf  
Amino Acid Sequences MSDSNQKSYLRDGSGPRAVDSKNRGSSRRDDDKQRSKHGSSRRPSDSKSSHRREASLASKSESPTFELDVIGQPSRAIVFGQTVETSVMVSLQCPSPEIAARYQGIDTSRLMGVVSLVAESRSGGCVPVECGTLTGQKMFDSVHECSSDIAESLARSHPTRLALGYLTFPQLLIRQPGSYRLRVTLIKMGGSGSSGGSTVLATDSETIRVERRSTGSSNSTSRRNGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.41
4 0.4
5 0.37
6 0.39
7 0.41
8 0.42
9 0.45
10 0.49
11 0.51
12 0.51
13 0.59
14 0.62
15 0.65
16 0.63
17 0.64
18 0.7
19 0.77
20 0.8
21 0.8
22 0.78
23 0.72
24 0.73
25 0.73
26 0.72
27 0.7
28 0.72
29 0.71
30 0.69
31 0.68
32 0.7
33 0.69
34 0.69
35 0.72
36 0.7
37 0.69
38 0.66
39 0.65
40 0.58
41 0.57
42 0.53
43 0.49
44 0.43
45 0.37
46 0.38
47 0.37
48 0.37
49 0.3
50 0.25
51 0.2
52 0.2
53 0.18
54 0.15
55 0.15
56 0.14
57 0.16
58 0.14
59 0.12
60 0.1
61 0.1
62 0.1
63 0.09
64 0.07
65 0.05
66 0.06
67 0.07
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.07
74 0.06
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.07
82 0.07
83 0.08
84 0.09
85 0.11
86 0.11
87 0.13
88 0.13
89 0.13
90 0.13
91 0.13
92 0.12
93 0.12
94 0.11
95 0.1
96 0.1
97 0.09
98 0.09
99 0.07
100 0.06
101 0.05
102 0.05
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.07
115 0.07
116 0.08
117 0.07
118 0.08
119 0.09
120 0.11
121 0.11
122 0.11
123 0.1
124 0.09
125 0.1
126 0.09
127 0.1
128 0.12
129 0.13
130 0.14
131 0.14
132 0.15
133 0.14
134 0.15
135 0.13
136 0.09
137 0.08
138 0.07
139 0.06
140 0.08
141 0.1
142 0.12
143 0.12
144 0.14
145 0.16
146 0.17
147 0.18
148 0.17
149 0.16
150 0.15
151 0.15
152 0.15
153 0.14
154 0.13
155 0.12
156 0.11
157 0.11
158 0.12
159 0.13
160 0.15
161 0.15
162 0.16
163 0.16
164 0.26
165 0.29
166 0.31
167 0.3
168 0.29
169 0.32
170 0.32
171 0.35
172 0.32
173 0.29
174 0.26
175 0.25
176 0.23
177 0.19
178 0.18
179 0.15
180 0.09
181 0.08
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.08
191 0.08
192 0.1
193 0.12
194 0.13
195 0.16
196 0.18
197 0.2
198 0.22
199 0.26
200 0.29
201 0.3
202 0.35
203 0.38
204 0.41
205 0.47
206 0.48
207 0.51
208 0.53