Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0S1S1

Protein Details
Accession A0A2I0S1S1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-90RSDSRKKDDIHKKKELHNARKRHMHSVBasic
NLS Segment(s)
PositionSequence
68-85RKKDDIHKKKELHNARKR
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MALSIPTWFSRYMTRPLHERPCRAIYKKLRADRPRQNVHDNLLLSAVRGCSMAINHKTLEEEPRSDSRKKDDIHKKKELHNARKRHMHSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.5
4 0.59
5 0.59
6 0.6
7 0.57
8 0.59
9 0.64
10 0.61
11 0.63
12 0.61
13 0.65
14 0.7
15 0.71
16 0.73
17 0.73
18 0.78
19 0.79
20 0.79
21 0.77
22 0.73
23 0.71
24 0.63
25 0.59
26 0.54
27 0.44
28 0.34
29 0.27
30 0.21
31 0.16
32 0.14
33 0.11
34 0.06
35 0.06
36 0.06
37 0.05
38 0.06
39 0.13
40 0.14
41 0.16
42 0.16
43 0.16
44 0.18
45 0.18
46 0.23
47 0.19
48 0.19
49 0.22
50 0.28
51 0.33
52 0.34
53 0.36
54 0.37
55 0.42
56 0.42
57 0.49
58 0.54
59 0.6
60 0.66
61 0.73
62 0.72
63 0.72
64 0.81
65 0.81
66 0.81
67 0.8
68 0.81
69 0.8
70 0.85