Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0S897

Protein Details
Accession A0A2I0S897   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-29FDKIRAKKELRRLEQRYTKRNKRTTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGLFDKIRAKKELRRLEQRYTKRNKRTTFYANAQYVDGEYVYTQDTGSSSTSAHSFGNDFVPANGKGSRTTRLFSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.76
4 0.81
5 0.82
6 0.81
7 0.81
8 0.82
9 0.82
10 0.84
11 0.8
12 0.75
13 0.74
14 0.71
15 0.68
16 0.64
17 0.62
18 0.55
19 0.5
20 0.44
21 0.36
22 0.29
23 0.21
24 0.15
25 0.07
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.07
34 0.08
35 0.07
36 0.07
37 0.08
38 0.08
39 0.1
40 0.1
41 0.09
42 0.09
43 0.1
44 0.12
45 0.12
46 0.12
47 0.11
48 0.15
49 0.15
50 0.17
51 0.17
52 0.16
53 0.2
54 0.23
55 0.29
56 0.28