Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0S6P6

Protein Details
Accession A0A2I0S6P6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-75YISCVYFHRRRKPAERKHSPSSLTHydrophilic
NLS Segment(s)
PositionSequence
61-68RRKPAERK
Subcellular Location(s) plas 17, E.R. 4, mito 3, golg 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MGDLGYRLSLMFLNIFFPPVAVLIMSGAEMTFAVNALLWLCAIIPSHVHGFYISCVYFHRRRKPAERKHSPSSLTHTYKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.09
5 0.09
6 0.08
7 0.08
8 0.05
9 0.05
10 0.04
11 0.05
12 0.05
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.06
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.12
40 0.1
41 0.09
42 0.11
43 0.17
44 0.25
45 0.33
46 0.42
47 0.46
48 0.54
49 0.65
50 0.74
51 0.79
52 0.83
53 0.85
54 0.83
55 0.84
56 0.84
57 0.76
58 0.7
59 0.67
60 0.66