Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0RY89

Protein Details
Accession A0A2I0RY89    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-35DGSPPRTPVKNKRTTWRDPDPRHNPRALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAKFPTSDGSPPRTPVKNKRTTWRDPDPRHNPRALYGAETPPSRSSPAENPDSSPEGGVKIMPTNEVRSFVASQSHDPKRLSAIPEEFNGQSDPNNVPQETILGVPKYTTDGRKRAQLLDQYEDVFQGPRAPALVDGVYRLKPPRAPTRNEGYLPYGARSSSPASHNPGRTLEEAAEAGGEPALRTVTAARKEGPMMARYATSRTAGDWVQGGNRPGSQEPSKRRRLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.66
4 0.68
5 0.71
6 0.78
7 0.8
8 0.81
9 0.81
10 0.82
11 0.82
12 0.8
13 0.85
14 0.85
15 0.86
16 0.83
17 0.78
18 0.68
19 0.6
20 0.58
21 0.48
22 0.42
23 0.37
24 0.35
25 0.35
26 0.34
27 0.34
28 0.3
29 0.31
30 0.28
31 0.24
32 0.24
33 0.27
34 0.33
35 0.37
36 0.35
37 0.36
38 0.38
39 0.4
40 0.35
41 0.28
42 0.23
43 0.17
44 0.16
45 0.14
46 0.11
47 0.1
48 0.1
49 0.13
50 0.13
51 0.17
52 0.18
53 0.2
54 0.19
55 0.2
56 0.21
57 0.19
58 0.23
59 0.2
60 0.23
61 0.29
62 0.32
63 0.34
64 0.33
65 0.33
66 0.32
67 0.35
68 0.33
69 0.29
70 0.29
71 0.27
72 0.27
73 0.29
74 0.24
75 0.22
76 0.2
77 0.15
78 0.12
79 0.12
80 0.13
81 0.15
82 0.17
83 0.16
84 0.15
85 0.15
86 0.15
87 0.13
88 0.13
89 0.1
90 0.08
91 0.08
92 0.08
93 0.08
94 0.1
95 0.11
96 0.15
97 0.19
98 0.25
99 0.26
100 0.32
101 0.34
102 0.33
103 0.35
104 0.35
105 0.33
106 0.31
107 0.3
108 0.25
109 0.24
110 0.22
111 0.18
112 0.13
113 0.1
114 0.09
115 0.08
116 0.07
117 0.07
118 0.07
119 0.07
120 0.08
121 0.09
122 0.06
123 0.08
124 0.1
125 0.1
126 0.12
127 0.13
128 0.13
129 0.16
130 0.21
131 0.31
132 0.35
133 0.4
134 0.44
135 0.51
136 0.54
137 0.53
138 0.49
139 0.42
140 0.39
141 0.35
142 0.31
143 0.23
144 0.18
145 0.17
146 0.17
147 0.16
148 0.16
149 0.19
150 0.21
151 0.28
152 0.34
153 0.35
154 0.36
155 0.35
156 0.35
157 0.33
158 0.31
159 0.25
160 0.2
161 0.18
162 0.15
163 0.13
164 0.1
165 0.08
166 0.07
167 0.06
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.08
174 0.15
175 0.2
176 0.22
177 0.23
178 0.25
179 0.26
180 0.3
181 0.3
182 0.25
183 0.23
184 0.22
185 0.23
186 0.22
187 0.24
188 0.22
189 0.2
190 0.19
191 0.18
192 0.2
193 0.19
194 0.19
195 0.17
196 0.16
197 0.19
198 0.22
199 0.23
200 0.21
201 0.22
202 0.25
203 0.25
204 0.31
205 0.35
206 0.4
207 0.49
208 0.57