Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0RIY7

Protein Details
Accession A0A2I0RIY7   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-129GIGRRSPTMARKKEKRRTSKEQLALAHydrophilic
NLS Segment(s)
PositionSequence
108-121RSPTMARKKEKRRT
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
Amino Acid Sequences MPPKAHDARNETSTVRERQIAAAAHARASKKNGQQAHQNGVIKYGELPKIHDYPDHAAQSQQGAGMQWDKAPLKLLDTYRVAHNLSTPAAFTSPYRQALLTNPGIGRRSPTMARKKEKRRTSKEQLALAVRKNFNGAAVNEMDVVAEMVYKVQNKGERNKSFAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.36
4 0.33
5 0.32
6 0.37
7 0.32
8 0.29
9 0.31
10 0.28
11 0.28
12 0.3
13 0.3
14 0.27
15 0.31
16 0.35
17 0.35
18 0.42
19 0.45
20 0.45
21 0.53
22 0.55
23 0.56
24 0.55
25 0.53
26 0.45
27 0.43
28 0.39
29 0.3
30 0.26
31 0.25
32 0.22
33 0.19
34 0.22
35 0.24
36 0.26
37 0.26
38 0.25
39 0.24
40 0.24
41 0.3
42 0.29
43 0.25
44 0.23
45 0.23
46 0.23
47 0.2
48 0.15
49 0.09
50 0.07
51 0.08
52 0.08
53 0.08
54 0.07
55 0.1
56 0.1
57 0.1
58 0.13
59 0.12
60 0.12
61 0.16
62 0.17
63 0.18
64 0.19
65 0.2
66 0.18
67 0.2
68 0.19
69 0.15
70 0.15
71 0.12
72 0.11
73 0.1
74 0.09
75 0.07
76 0.07
77 0.08
78 0.07
79 0.11
80 0.14
81 0.16
82 0.16
83 0.16
84 0.17
85 0.19
86 0.24
87 0.2
88 0.19
89 0.18
90 0.19
91 0.2
92 0.19
93 0.19
94 0.16
95 0.18
96 0.2
97 0.29
98 0.37
99 0.45
100 0.55
101 0.62
102 0.71
103 0.78
104 0.84
105 0.86
106 0.85
107 0.86
108 0.87
109 0.87
110 0.83
111 0.78
112 0.73
113 0.69
114 0.64
115 0.6
116 0.57
117 0.48
118 0.41
119 0.38
120 0.33
121 0.27
122 0.27
123 0.22
124 0.18
125 0.19
126 0.19
127 0.17
128 0.17
129 0.15
130 0.1
131 0.1
132 0.06
133 0.05
134 0.04
135 0.05
136 0.08
137 0.1
138 0.11
139 0.16
140 0.23
141 0.28
142 0.39
143 0.48
144 0.51