Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0S003

Protein Details
Accession A0A2I0S003    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-59GSAISICLNRRRKRRQRKNVQYLNPKLRGGHydrophilic
NLS Segment(s)
PositionSequence
39-47RRRKRRQRK
Subcellular Location(s) nucl 6mito 6mito_nucl 6, extr 4, golg 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPAENKFPLSTTQIIIIVVAVLIGVVLIGSAISICLNRRRKRRQRKNVQYLNPKLRGGADDEAEVVEFMKAGSFDSTHLASCELDSSRPPCELGYSTRPLSEVPRTLQPGQSNTALPAYSPMAVVNNGAPTTTVELEDTSRRELPLSTSDEVLQPIPLNFSRPARGNTVLTCDTKGFHRGPDHETEHPRHTATPEVDDVMKPANPKRCSSPTIPKRLQSINKDRCGRYRQRSPVSPLTSPDRSPQSERKRRLQEWLSPSVQPLDEVQLEEEEEEEKEEEEDPVYYVMSAQVYET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.17
5 0.12
6 0.09
7 0.07
8 0.04
9 0.03
10 0.03
11 0.02
12 0.02
13 0.01
14 0.01
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.05
22 0.08
23 0.17
24 0.28
25 0.36
26 0.47
27 0.58
28 0.69
29 0.8
30 0.88
31 0.91
32 0.92
33 0.96
34 0.97
35 0.96
36 0.95
37 0.94
38 0.93
39 0.91
40 0.85
41 0.73
42 0.63
43 0.54
44 0.45
45 0.39
46 0.32
47 0.23
48 0.18
49 0.18
50 0.17
51 0.16
52 0.14
53 0.1
54 0.06
55 0.05
56 0.04
57 0.05
58 0.04
59 0.05
60 0.06
61 0.06
62 0.07
63 0.1
64 0.11
65 0.11
66 0.11
67 0.11
68 0.1
69 0.1
70 0.12
71 0.1
72 0.1
73 0.12
74 0.14
75 0.15
76 0.15
77 0.16
78 0.13
79 0.15
80 0.16
81 0.19
82 0.24
83 0.26
84 0.26
85 0.26
86 0.27
87 0.25
88 0.26
89 0.26
90 0.23
91 0.21
92 0.26
93 0.3
94 0.31
95 0.33
96 0.32
97 0.3
98 0.29
99 0.29
100 0.24
101 0.2
102 0.2
103 0.16
104 0.13
105 0.12
106 0.1
107 0.09
108 0.09
109 0.08
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.08
120 0.08
121 0.08
122 0.07
123 0.08
124 0.09
125 0.11
126 0.12
127 0.12
128 0.12
129 0.12
130 0.12
131 0.12
132 0.13
133 0.16
134 0.19
135 0.17
136 0.17
137 0.18
138 0.18
139 0.18
140 0.16
141 0.11
142 0.08
143 0.07
144 0.09
145 0.08
146 0.1
147 0.12
148 0.13
149 0.15
150 0.18
151 0.2
152 0.22
153 0.24
154 0.22
155 0.21
156 0.25
157 0.25
158 0.24
159 0.23
160 0.19
161 0.17
162 0.17
163 0.21
164 0.17
165 0.18
166 0.21
167 0.23
168 0.26
169 0.33
170 0.35
171 0.36
172 0.41
173 0.41
174 0.4
175 0.39
176 0.36
177 0.31
178 0.28
179 0.28
180 0.24
181 0.23
182 0.2
183 0.2
184 0.2
185 0.19
186 0.18
187 0.14
188 0.14
189 0.13
190 0.18
191 0.25
192 0.27
193 0.29
194 0.36
195 0.4
196 0.43
197 0.48
198 0.54
199 0.54
200 0.63
201 0.65
202 0.61
203 0.61
204 0.64
205 0.65
206 0.64
207 0.66
208 0.65
209 0.69
210 0.73
211 0.69
212 0.69
213 0.7
214 0.7
215 0.68
216 0.69
217 0.71
218 0.72
219 0.77
220 0.77
221 0.78
222 0.74
223 0.66
224 0.6
225 0.57
226 0.52
227 0.47
228 0.45
229 0.41
230 0.4
231 0.44
232 0.51
233 0.55
234 0.62
235 0.67
236 0.72
237 0.75
238 0.74
239 0.77
240 0.74
241 0.72
242 0.69
243 0.7
244 0.63
245 0.54
246 0.52
247 0.46
248 0.38
249 0.3
250 0.24
251 0.21
252 0.19
253 0.19
254 0.19
255 0.16
256 0.16
257 0.15
258 0.14
259 0.1
260 0.09
261 0.1
262 0.1
263 0.09
264 0.1
265 0.11
266 0.11
267 0.11
268 0.12
269 0.11
270 0.11
271 0.1
272 0.09
273 0.09
274 0.1
275 0.1