Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0S003

Protein Details
Accession A0A2I0S003   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-59GSAISICLNRRRKRRQRKNVQYLNPKLRGGHydrophilic
NLS Segment(s)
PositionSequence
39-47RRRKRRQRK
Subcellular Location(s) nucl 6, mito 6, mito_nucl 6, extr 4, golg 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPAENKFPLSTTQIIIIVVAVLIGVVLIGSAISICLNRRRKRRQRKNVQYLNPKLRGGADDEAEVVEFMKAGSFDSTHLASCELDSSRPPCELGYSTRPLSEVPRTLQPGQSNTALPAYSPMAVVNNGAPTTTVELEDTSRRELPLSTSDEVLQPIPLNFSRPARGNTVLTCDTKGFHRGPDHETEHPRHTATPEVDDVMKPANPKRCSSPTIPKRLQSINKDRCGRYRQRSPVSPLTSPDRSPQSERKRRLQEWLSPSVQPLDEVQLEEEEEEEKEEEEDPVYYVMSAQVYET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.17
5 0.12
6 0.09
7 0.07
8 0.04
9 0.03
10 0.03
11 0.02
12 0.02
13 0.01
14 0.01
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.05
22 0.08
23 0.17
24 0.28
25 0.36
26 0.47
27 0.58
28 0.69
29 0.8
30 0.88
31 0.91
32 0.92
33 0.96
34 0.97
35 0.96
36 0.95
37 0.94
38 0.93
39 0.91
40 0.85
41 0.73
42 0.63
43 0.54
44 0.45
45 0.39
46 0.32
47 0.23
48 0.18
49 0.18
50 0.17
51 0.16
52 0.14
53 0.1
54 0.06
55 0.05
56 0.04
57 0.05
58 0.04
59 0.05
60 0.06
61 0.06
62 0.07
63 0.1
64 0.11
65 0.11
66 0.11
67 0.11
68 0.1
69 0.1
70 0.12
71 0.1
72 0.1
73 0.12
74 0.14
75 0.15
76 0.15
77 0.16
78 0.13
79 0.15
80 0.16
81 0.19
82 0.24
83 0.26
84 0.26
85 0.26
86 0.27
87 0.25
88 0.26
89 0.26
90 0.23
91 0.21
92 0.26
93 0.3
94 0.31
95 0.33
96 0.32
97 0.3
98 0.29
99 0.29
100 0.24
101 0.2
102 0.2
103 0.16
104 0.13
105 0.12
106 0.1
107 0.09
108 0.09
109 0.08
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.08
120 0.08
121 0.08
122 0.07
123 0.08
124 0.09
125 0.11
126 0.12
127 0.12
128 0.12
129 0.12
130 0.12
131 0.12
132 0.13
133 0.16
134 0.19
135 0.17
136 0.17
137 0.18
138 0.18
139 0.18
140 0.16
141 0.11
142 0.08
143 0.07
144 0.09
145 0.08
146 0.1
147 0.12
148 0.13
149 0.15
150 0.18
151 0.2
152 0.22
153 0.24
154 0.22
155 0.21
156 0.25
157 0.25
158 0.24
159 0.23
160 0.19
161 0.17
162 0.17
163 0.21
164 0.17
165 0.18
166 0.21
167 0.23
168 0.26
169 0.33
170 0.35
171 0.36
172 0.41
173 0.41
174 0.4
175 0.39
176 0.36
177 0.31
178 0.28
179 0.28
180 0.24
181 0.23
182 0.2
183 0.2
184 0.2
185 0.19
186 0.18
187 0.14
188 0.14
189 0.13
190 0.18
191 0.25
192 0.27
193 0.29
194 0.36
195 0.4
196 0.43
197 0.48
198 0.54
199 0.54
200 0.63
201 0.65
202 0.61
203 0.61
204 0.64
205 0.65
206 0.64
207 0.66
208 0.65
209 0.69
210 0.73
211 0.69
212 0.69
213 0.7
214 0.7
215 0.68
216 0.69
217 0.71
218 0.72
219 0.77
220 0.77
221 0.78
222 0.74
223 0.66
224 0.6
225 0.57
226 0.52
227 0.47
228 0.45
229 0.41
230 0.4
231 0.44
232 0.51
233 0.55
234 0.62
235 0.67
236 0.72
237 0.75
238 0.74
239 0.77
240 0.74
241 0.72
242 0.69
243 0.7
244 0.63
245 0.54
246 0.52
247 0.46
248 0.38
249 0.3
250 0.24
251 0.21
252 0.19
253 0.19
254 0.19
255 0.16
256 0.16
257 0.15
258 0.14
259 0.1
260 0.09
261 0.1
262 0.1
263 0.09
264 0.1
265 0.11
266 0.11
267 0.11
268 0.12
269 0.11
270 0.11
271 0.1
272 0.09
273 0.09
274 0.1
275 0.1