Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0RPM3

Protein Details
Accession A0A2I0RPM3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-71VRPVRIGRRRERRKIVPAAEBasic
NLS Segment(s)
PositionSequence
56-65RIGRRRERRK
Subcellular Location(s) cyto 20, pero 3, nucl 2
Family & Domain DBs
Amino Acid Sequences MGGSSETAIETDATATESESANTGQAIAVPGTKVEFVICPLSIGKLQFEIVVRPVRIGRRRERRKIVPAAEETETEKRREIGNASWWVQVTVVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.08
9 0.08
10 0.08
11 0.06
12 0.07
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.07
24 0.09
25 0.08
26 0.08
27 0.09
28 0.1
29 0.1
30 0.1
31 0.09
32 0.08
33 0.08
34 0.08
35 0.09
36 0.08
37 0.1
38 0.13
39 0.13
40 0.13
41 0.15
42 0.21
43 0.27
44 0.33
45 0.4
46 0.49
47 0.59
48 0.67
49 0.74
50 0.76
51 0.79
52 0.81
53 0.77
54 0.72
55 0.66
56 0.61
57 0.53
58 0.45
59 0.4
60 0.4
61 0.36
62 0.31
63 0.29
64 0.26
65 0.26
66 0.28
67 0.28
68 0.25
69 0.31
70 0.37
71 0.38
72 0.39
73 0.37
74 0.34
75 0.31