Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0RIJ0

Protein Details
Accession A0A2I0RIJ0    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-41TQSSTPKMSRQPRNITKNQTLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_nucl 9.5, pero 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR020347  Pop8  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0006379  P:mRNA cleavage  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MAEVENLPDAPSTTTDAQQATQSSTPKMSRQPRNITKNQTLSEFSIRKPDWVYIRLQHLSSKTAQTLDGVTAQLHLNAALSAFLGLHGSAIPIDILHLQEQDVWIRAPAEERAAVIAAVGGWISSSGEGWRVRGWSHWNANAFGRDAGQDLFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.21
4 0.21
5 0.22
6 0.22
7 0.21
8 0.23
9 0.24
10 0.23
11 0.27
12 0.29
13 0.3
14 0.38
15 0.43
16 0.5
17 0.57
18 0.66
19 0.71
20 0.78
21 0.81
22 0.81
23 0.79
24 0.76
25 0.68
26 0.61
27 0.53
28 0.48
29 0.48
30 0.42
31 0.34
32 0.36
33 0.34
34 0.33
35 0.32
36 0.32
37 0.28
38 0.28
39 0.31
40 0.26
41 0.32
42 0.31
43 0.31
44 0.29
45 0.26
46 0.27
47 0.25
48 0.23
49 0.18
50 0.17
51 0.16
52 0.14
53 0.13
54 0.11
55 0.1
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.06
63 0.05
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.05
83 0.06
84 0.06
85 0.06
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.09
95 0.1
96 0.11
97 0.1
98 0.1
99 0.11
100 0.11
101 0.1
102 0.08
103 0.07
104 0.05
105 0.04
106 0.04
107 0.03
108 0.02
109 0.03
110 0.03
111 0.03
112 0.04
113 0.05
114 0.1
115 0.11
116 0.12
117 0.14
118 0.15
119 0.16
120 0.2
121 0.26
122 0.3
123 0.37
124 0.41
125 0.42
126 0.43
127 0.47
128 0.45
129 0.4
130 0.32
131 0.26
132 0.21
133 0.2