Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I0S8Z7

Protein Details
Accession A0A2I0S8Z7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
152-171VDATRLKQGGPRSKKPRRLGBasic
NLS Segment(s)
PositionSequence
159-171QGGPRSKKPRRLG
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001971  Ribosomal_S11  
IPR036967  Ribosomal_S11_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MLDPDKERLPNSTFANEIAGGPRDQPHRLHIYATKHNTHITFVQPSRPASQTASSGVSGTSASAKDQNKMVDVLLSLSAGNIGFRKAGRGSYDAAYQLAAFTLKQMQEKGMLRDMHSLQVVLRGFGAGREAVTKVLLGSEGRMIRNSIVSVVDATRLKQGGPRSKKPRRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.27
4 0.24
5 0.21
6 0.18
7 0.16
8 0.16
9 0.2
10 0.21
11 0.24
12 0.25
13 0.27
14 0.32
15 0.33
16 0.35
17 0.36
18 0.4
19 0.47
20 0.51
21 0.49
22 0.44
23 0.47
24 0.43
25 0.4
26 0.35
27 0.3
28 0.31
29 0.29
30 0.33
31 0.33
32 0.34
33 0.35
34 0.34
35 0.31
36 0.26
37 0.28
38 0.23
39 0.22
40 0.22
41 0.18
42 0.17
43 0.15
44 0.13
45 0.11
46 0.09
47 0.08
48 0.07
49 0.07
50 0.13
51 0.14
52 0.15
53 0.18
54 0.18
55 0.18
56 0.18
57 0.17
58 0.12
59 0.11
60 0.1
61 0.08
62 0.07
63 0.06
64 0.05
65 0.05
66 0.04
67 0.05
68 0.04
69 0.04
70 0.05
71 0.05
72 0.07
73 0.07
74 0.09
75 0.1
76 0.12
77 0.14
78 0.14
79 0.15
80 0.14
81 0.14
82 0.12
83 0.1
84 0.09
85 0.07
86 0.06
87 0.04
88 0.04
89 0.07
90 0.09
91 0.1
92 0.11
93 0.11
94 0.17
95 0.2
96 0.22
97 0.25
98 0.25
99 0.25
100 0.3
101 0.3
102 0.26
103 0.24
104 0.21
105 0.15
106 0.19
107 0.18
108 0.13
109 0.12
110 0.1
111 0.1
112 0.1
113 0.11
114 0.06
115 0.06
116 0.07
117 0.08
118 0.08
119 0.09
120 0.08
121 0.07
122 0.07
123 0.08
124 0.07
125 0.07
126 0.12
127 0.15
128 0.16
129 0.17
130 0.18
131 0.17
132 0.19
133 0.19
134 0.14
135 0.12
136 0.12
137 0.13
138 0.12
139 0.16
140 0.15
141 0.16
142 0.19
143 0.19
144 0.19
145 0.21
146 0.3
147 0.36
148 0.45
149 0.55
150 0.61
151 0.71