Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MN33

Protein Details
Accession B8MN33    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTRRITKEQRLRKRHVRQRNERRISLMHydrophilic
NLS Segment(s)
PositionSequence
10-19RLRKRHVRQR
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MTRRITKEQRLRKRHVRQRNERRISLMHKAYKYGTICHADIFLGIRLKENGHVFTFQSDRLGFWSPMTTHLKSYFPVPFCMTSDDFEKPTELVQTKPNHLEMELSRHSLFSPVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.9
4 0.9
5 0.92
6 0.94
7 0.91
8 0.83
9 0.77
10 0.72
11 0.67
12 0.65
13 0.62
14 0.57
15 0.5
16 0.5
17 0.46
18 0.46
19 0.41
20 0.34
21 0.3
22 0.27
23 0.27
24 0.25
25 0.24
26 0.18
27 0.17
28 0.16
29 0.13
30 0.11
31 0.11
32 0.12
33 0.12
34 0.12
35 0.15
36 0.15
37 0.15
38 0.14
39 0.15
40 0.14
41 0.15
42 0.16
43 0.12
44 0.13
45 0.11
46 0.1
47 0.11
48 0.14
49 0.12
50 0.12
51 0.14
52 0.12
53 0.18
54 0.23
55 0.21
56 0.21
57 0.23
58 0.24
59 0.22
60 0.25
61 0.25
62 0.21
63 0.23
64 0.23
65 0.23
66 0.23
67 0.27
68 0.24
69 0.21
70 0.23
71 0.23
72 0.22
73 0.21
74 0.2
75 0.16
76 0.16
77 0.21
78 0.18
79 0.18
80 0.24
81 0.28
82 0.33
83 0.36
84 0.37
85 0.32
86 0.31
87 0.34
88 0.29
89 0.33
90 0.31
91 0.31
92 0.29
93 0.28
94 0.28