Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I0S3H4

Protein Details
Accession A0A2I0S3H4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-78FSPDNEKKKRKFLKERLRHDLPMBasic
NLS Segment(s)
PositionSequence
62-69KKKRKFLK
Subcellular Location(s) mito 12, plas 6, pero 3, cyto 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQVRVEVMFKMRVIVMTGVKISIFVLLSPLHTRKISLKIWYSPSPSPMRFACRQAFSPDNEKKKRKFLKERLRHDLPMCKTHNVAVKLICGSCRVPVMDNSAASPCRCFCMREAEHAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.16
5 0.15
6 0.14
7 0.14
8 0.11
9 0.1
10 0.08
11 0.06
12 0.08
13 0.08
14 0.1
15 0.14
16 0.15
17 0.17
18 0.17
19 0.19
20 0.21
21 0.28
22 0.29
23 0.3
24 0.33
25 0.35
26 0.41
27 0.43
28 0.44
29 0.38
30 0.4
31 0.4
32 0.36
33 0.35
34 0.31
35 0.33
36 0.31
37 0.35
38 0.34
39 0.3
40 0.32
41 0.33
42 0.34
43 0.3
44 0.36
45 0.38
46 0.43
47 0.49
48 0.54
49 0.52
50 0.6
51 0.66
52 0.67
53 0.71
54 0.73
55 0.76
56 0.8
57 0.86
58 0.84
59 0.81
60 0.74
61 0.67
62 0.64
63 0.57
64 0.55
65 0.49
66 0.42
67 0.37
68 0.37
69 0.41
70 0.35
71 0.33
72 0.26
73 0.25
74 0.25
75 0.25
76 0.22
77 0.18
78 0.16
79 0.15
80 0.17
81 0.16
82 0.16
83 0.17
84 0.23
85 0.24
86 0.24
87 0.24
88 0.25
89 0.26
90 0.25
91 0.26
92 0.2
93 0.21
94 0.22
95 0.22
96 0.21
97 0.3
98 0.31