Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FN83

Protein Details
Accession A0A2I2FN83    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MDPRQLKKGQAKFVPRRSQRPGFRKRFRDNIQGIHydrophilic
NLS Segment(s)
PositionSequence
7-46KKGQAKFVPRRSQRPGFRKRFRDNIQGITKPAIRRLARRG
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPRQLKKGQAKFVPRRSQRPGFRKRFRDNIQGITKPAIRRLARRGGVVRIKADVYNEIRVAVKIRLTEIMRHIVLLLESVQTERYERKVITTRDVVFALNRMGSTLYGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.8
4 0.8
5 0.82
6 0.81
7 0.82
8 0.82
9 0.83
10 0.85
11 0.87
12 0.86
13 0.86
14 0.82
15 0.81
16 0.75
17 0.73
18 0.7
19 0.63
20 0.56
21 0.5
22 0.47
23 0.38
24 0.37
25 0.36
26 0.31
27 0.33
28 0.38
29 0.43
30 0.41
31 0.44
32 0.43
33 0.42
34 0.45
35 0.42
36 0.36
37 0.28
38 0.27
39 0.24
40 0.22
41 0.19
42 0.16
43 0.16
44 0.15
45 0.14
46 0.14
47 0.14
48 0.15
49 0.12
50 0.11
51 0.1
52 0.11
53 0.14
54 0.15
55 0.17
56 0.18
57 0.21
58 0.2
59 0.19
60 0.19
61 0.15
62 0.14
63 0.12
64 0.1
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.09
71 0.11
72 0.14
73 0.18
74 0.18
75 0.24
76 0.31
77 0.34
78 0.39
79 0.43
80 0.42
81 0.41
82 0.42
83 0.36
84 0.28
85 0.28
86 0.24
87 0.18
88 0.16
89 0.13
90 0.14