Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2EYE7

Protein Details
Accession A0A2I2EYE7    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-47MQQKWMSFCKKGRRRRRKRREREKKKEEEEKKKRRRREKGAVSVDNRBasic
NLS Segment(s)
PositionSequence
10-40KKGRRRRRKRREREKKKEEEEKKKRRRREKG
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MQQKWMSFCKKGRRRRRKRREREKKKEEEEKKKRRRREKGAVSVDNRKVKSSGEEDCCVILIGLLQTEGITGDENEKHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.91
3 0.94
4 0.95
5 0.97
6 0.97
7 0.98
8 0.98
9 0.97
10 0.97
11 0.96
12 0.94
13 0.93
14 0.92
15 0.92
16 0.91
17 0.91
18 0.91
19 0.89
20 0.89
21 0.89
22 0.89
23 0.88
24 0.88
25 0.87
26 0.86
27 0.87
28 0.84
29 0.77
30 0.75
31 0.71
32 0.66
33 0.56
34 0.46
35 0.38
36 0.32
37 0.32
38 0.28
39 0.29
40 0.28
41 0.29
42 0.29
43 0.28
44 0.28
45 0.23
46 0.19
47 0.12
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.1