Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FJM5

Protein Details
Accession A0A2I2FJM5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-97PVGVEARHRHRSRRRRSPTYEYVEKPBasic
NLS Segment(s)
PositionSequence
79-87HRHRSRRRR
Subcellular Location(s) extr 11, plas 8, mito 4, E.R. 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPILDNNVRPNILHARQSSSNECPSTISGGGIAGIVIGTIVGTLLIQWLIRLCQLPGARGEASPDYKYSTPVGVEARHRHRSRRRRSPTYEYVEKPSGSVRRPAKVYLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.38
4 0.42
5 0.46
6 0.47
7 0.43
8 0.45
9 0.4
10 0.38
11 0.33
12 0.3
13 0.28
14 0.23
15 0.18
16 0.12
17 0.11
18 0.11
19 0.09
20 0.08
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.05
39 0.05
40 0.05
41 0.1
42 0.1
43 0.11
44 0.12
45 0.14
46 0.14
47 0.14
48 0.16
49 0.13
50 0.16
51 0.16
52 0.15
53 0.16
54 0.16
55 0.17
56 0.17
57 0.15
58 0.13
59 0.15
60 0.16
61 0.16
62 0.22
63 0.29
64 0.35
65 0.44
66 0.46
67 0.53
68 0.61
69 0.69
70 0.74
71 0.77
72 0.8
73 0.81
74 0.87
75 0.88
76 0.87
77 0.85
78 0.83
79 0.75
80 0.72
81 0.66
82 0.57
83 0.48
84 0.46
85 0.43
86 0.37
87 0.42
88 0.4
89 0.44
90 0.47