Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FEY1

Protein Details
Accession A0A2I2FEY1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRNREIKGCKTRQKEEKGQKVTIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9, cyto_nucl 6, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRNREIKGCKTRQKEEKGQKVTISIPSTGLFFFFFSLSSFQGLCRLQLTVPNPDSQSVGAVISMPIRLWEIRCKKIVQSLYSPARITWASTFHIRYSSSLVSQSRSSTWKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.85
4 0.82
5 0.77
6 0.68
7 0.61
8 0.55
9 0.5
10 0.42
11 0.32
12 0.26
13 0.23
14 0.23
15 0.2
16 0.17
17 0.11
18 0.09
19 0.09
20 0.08
21 0.08
22 0.08
23 0.1
24 0.1
25 0.1
26 0.1
27 0.09
28 0.14
29 0.14
30 0.13
31 0.12
32 0.12
33 0.11
34 0.15
35 0.17
36 0.19
37 0.19
38 0.21
39 0.21
40 0.2
41 0.21
42 0.16
43 0.15
44 0.09
45 0.08
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.06
55 0.08
56 0.17
57 0.23
58 0.27
59 0.3
60 0.31
61 0.31
62 0.38
63 0.42
64 0.36
65 0.35
66 0.4
67 0.43
68 0.45
69 0.43
70 0.36
71 0.34
72 0.3
73 0.27
74 0.21
75 0.19
76 0.19
77 0.23
78 0.25
79 0.23
80 0.26
81 0.25
82 0.24
83 0.27
84 0.26
85 0.23
86 0.28
87 0.28
88 0.28
89 0.29
90 0.3
91 0.28