Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FMF5

Protein Details
Accession A0A2I2FMF5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
197-222VSEDERERQRRVPRNPKKRMVEVDLLHydrophilic
NLS Segment(s)
PositionSequence
207-214RVPRNPKK
Subcellular Location(s) nucl 11, mito_nucl 10.833, mito 9.5, cyto_nucl 9.333, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002125  CMP_dCMP_dom  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF18785  Inv-AAD  
PROSITE View protein in PROSITE  
PS51747  CYT_DCMP_DEAMINASES_2  
Amino Acid Sequences MASPHHKYLQSCLALAEQSPPRPTNFRVGAILVSRKAQDDLYYEDDRVLSTGYTMELEGNTHAEQCCLSKYAAAQGVPDERVAEVLPSEASRQLVMYVTMEPCGKRLSGNQPCVQRIVDTRRGDRRGIEKVYFGVKEPETFVGASESCRRLTDAGIQWRVVQGLEKDILSVATAGHEHSEEEVRAALDKVETRLDDVSEDERERQRRVPRNPKKRMVEVDLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.24
5 0.26
6 0.3
7 0.31
8 0.32
9 0.36
10 0.38
11 0.41
12 0.4
13 0.39
14 0.36
15 0.36
16 0.35
17 0.35
18 0.36
19 0.28
20 0.25
21 0.23
22 0.22
23 0.22
24 0.2
25 0.18
26 0.17
27 0.21
28 0.25
29 0.26
30 0.25
31 0.24
32 0.24
33 0.22
34 0.19
35 0.14
36 0.08
37 0.06
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.06
44 0.07
45 0.07
46 0.09
47 0.09
48 0.1
49 0.1
50 0.1
51 0.1
52 0.1
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.15
59 0.18
60 0.17
61 0.16
62 0.16
63 0.18
64 0.18
65 0.17
66 0.13
67 0.09
68 0.1
69 0.09
70 0.08
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.09
90 0.1
91 0.09
92 0.08
93 0.12
94 0.22
95 0.29
96 0.33
97 0.37
98 0.39
99 0.4
100 0.41
101 0.37
102 0.27
103 0.24
104 0.27
105 0.31
106 0.3
107 0.35
108 0.41
109 0.43
110 0.43
111 0.41
112 0.39
113 0.38
114 0.39
115 0.35
116 0.28
117 0.27
118 0.3
119 0.27
120 0.23
121 0.2
122 0.16
123 0.16
124 0.17
125 0.16
126 0.14
127 0.14
128 0.13
129 0.11
130 0.11
131 0.12
132 0.16
133 0.16
134 0.16
135 0.16
136 0.17
137 0.15
138 0.17
139 0.23
140 0.25
141 0.32
142 0.33
143 0.33
144 0.33
145 0.33
146 0.32
147 0.24
148 0.19
149 0.11
150 0.12
151 0.13
152 0.13
153 0.12
154 0.12
155 0.12
156 0.09
157 0.09
158 0.06
159 0.05
160 0.06
161 0.06
162 0.07
163 0.07
164 0.07
165 0.09
166 0.11
167 0.1
168 0.11
169 0.11
170 0.11
171 0.12
172 0.12
173 0.11
174 0.1
175 0.12
176 0.13
177 0.16
178 0.16
179 0.17
180 0.18
181 0.18
182 0.16
183 0.17
184 0.19
185 0.2
186 0.21
187 0.25
188 0.31
189 0.35
190 0.38
191 0.43
192 0.5
193 0.55
194 0.65
195 0.71
196 0.75
197 0.82
198 0.89
199 0.92
200 0.9
201 0.89
202 0.86
203 0.82