Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FIS7

Protein Details
Accession A0A2I2FIS7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-67LHIHPPHKPTKRKEKTQNKRKRESGKRAPKWPNAQAQGBasic
NLS Segment(s)
PositionSequence
35-60PHKPTKRKEKTQNKRKRESGKRAPKW
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences GKTLCTSHKDAVERKEKKQYSDVNISGISLHIHPPHKPTKRKEKTQNKRKRESGKRAPKWPNAQAQGNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.61
4 0.59
5 0.62
6 0.6
7 0.56
8 0.6
9 0.55
10 0.47
11 0.44
12 0.4
13 0.31
14 0.24
15 0.17
16 0.09
17 0.1
18 0.11
19 0.13
20 0.13
21 0.18
22 0.27
23 0.35
24 0.42
25 0.48
26 0.56
27 0.64
28 0.73
29 0.8
30 0.82
31 0.85
32 0.88
33 0.92
34 0.9
35 0.9
36 0.89
37 0.89
38 0.88
39 0.88
40 0.88
41 0.89
42 0.88
43 0.89
44 0.89
45 0.88
46 0.86
47 0.83
48 0.82
49 0.77