Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2F6D9

Protein Details
Accession A0A2I2F6D9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-47FGRLVRFQRRWRRRTRAAFTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 4, plas 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLQTPLHLFPRNPSRIVGLLVVGEGAAFGRLVRFQRRWRRRTRAAFTPALAFALGFLVFCPRSQIRYAGYNLVVFLESMVYGCQGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.37
4 0.3
5 0.2
6 0.16
7 0.14
8 0.13
9 0.08
10 0.06
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.06
18 0.09
19 0.15
20 0.2
21 0.29
22 0.4
23 0.51
24 0.58
25 0.66
26 0.73
27 0.78
28 0.83
29 0.8
30 0.78
31 0.74
32 0.68
33 0.59
34 0.51
35 0.41
36 0.31
37 0.25
38 0.15
39 0.09
40 0.07
41 0.06
42 0.04
43 0.04
44 0.07
45 0.07
46 0.07
47 0.12
48 0.13
49 0.15
50 0.17
51 0.21
52 0.21
53 0.26
54 0.28
55 0.28
56 0.28
57 0.26
58 0.24
59 0.22
60 0.19
61 0.14
62 0.11
63 0.08
64 0.06
65 0.06
66 0.06