Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2F949

Protein Details
Accession A0A2I2F949    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-108PSLPSFPQKGRERKEKKRSTNPSGPQPQRSHydrophilic
NLS Segment(s)
PositionSequence
87-96KGRERKEKKR
Subcellular Location(s) nucl 22, cyto_nucl 15, cyto 4
Family & Domain DBs
Amino Acid Sequences MSMPPPNPTLYLKKNQTKAKSNQVTPNSCASCHMDQVTPYIHTPYSPSLPARLRIAPGYDIVNPHNYLNKRMYVCVQIPSLPSFPQKGRERKEKKRSTNPSGPQPQRSNQVSTAKTSILSPQETAQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.74
4 0.75
5 0.75
6 0.76
7 0.76
8 0.73
9 0.74
10 0.74
11 0.7
12 0.64
13 0.65
14 0.55
15 0.46
16 0.43
17 0.39
18 0.32
19 0.3
20 0.29
21 0.22
22 0.21
23 0.23
24 0.22
25 0.18
26 0.17
27 0.16
28 0.14
29 0.13
30 0.15
31 0.15
32 0.16
33 0.16
34 0.16
35 0.2
36 0.22
37 0.24
38 0.25
39 0.23
40 0.22
41 0.21
42 0.22
43 0.17
44 0.16
45 0.15
46 0.13
47 0.13
48 0.13
49 0.14
50 0.14
51 0.13
52 0.17
53 0.16
54 0.19
55 0.2
56 0.23
57 0.22
58 0.22
59 0.24
60 0.23
61 0.23
62 0.23
63 0.21
64 0.18
65 0.19
66 0.2
67 0.19
68 0.16
69 0.17
70 0.17
71 0.18
72 0.26
73 0.33
74 0.4
75 0.46
76 0.56
77 0.64
78 0.72
79 0.82
80 0.83
81 0.85
82 0.87
83 0.9
84 0.88
85 0.89
86 0.85
87 0.84
88 0.85
89 0.8
90 0.78
91 0.74
92 0.69
93 0.67
94 0.64
95 0.58
96 0.54
97 0.57
98 0.5
99 0.49
100 0.47
101 0.39
102 0.36
103 0.32
104 0.31
105 0.27
106 0.28
107 0.25