Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FDI5

Protein Details
Accession A0A2I2FDI5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-110APALTPKKTPTKRRKKEVAAAETHydrophilic
119-140EVVTPKPKRQRKTPAKKAGASTHydrophilic
NLS Segment(s)
PositionSequence
94-103KKTPTKRRKK
124-136KPKRQRKTPAKKA
Subcellular Location(s) cyto 9.5, cyto_nucl 8, E.R. 7, nucl 5.5, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MATKGKPEGLVGLSVAEAKVLLLGILCTDKTGKLDGDRLAAKGNYKNGASAKTMYRVARKALFEKNPGEDSLSPTAADAAAPADDTAAPALTPKKTPTKRRKKEVAAAETDPSGGTEDEVVTPKPKRQRKTPAKKAGASTPAPNIETGNTGVPSMTSNPHKGIKVEGETSALTSSRPTLKCEDSDSTTTSELIVKGALDDGDAIMTNAELDAELNHLGDDARAAIKMEDVEHEVDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.08
4 0.07
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.04
11 0.05
12 0.07
13 0.07
14 0.07
15 0.09
16 0.1
17 0.11
18 0.14
19 0.15
20 0.16
21 0.21
22 0.22
23 0.26
24 0.27
25 0.26
26 0.27
27 0.26
28 0.27
29 0.27
30 0.29
31 0.28
32 0.26
33 0.3
34 0.28
35 0.3
36 0.29
37 0.28
38 0.26
39 0.26
40 0.31
41 0.3
42 0.34
43 0.34
44 0.35
45 0.38
46 0.38
47 0.4
48 0.43
49 0.45
50 0.44
51 0.45
52 0.45
53 0.41
54 0.38
55 0.36
56 0.28
57 0.28
58 0.26
59 0.24
60 0.19
61 0.17
62 0.17
63 0.13
64 0.12
65 0.08
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.04
75 0.04
76 0.05
77 0.08
78 0.08
79 0.1
80 0.13
81 0.23
82 0.31
83 0.42
84 0.51
85 0.61
86 0.69
87 0.77
88 0.84
89 0.81
90 0.82
91 0.8
92 0.75
93 0.68
94 0.61
95 0.52
96 0.42
97 0.35
98 0.27
99 0.17
100 0.12
101 0.07
102 0.05
103 0.05
104 0.05
105 0.06
106 0.07
107 0.07
108 0.09
109 0.1
110 0.14
111 0.22
112 0.28
113 0.32
114 0.4
115 0.51
116 0.6
117 0.71
118 0.78
119 0.81
120 0.81
121 0.8
122 0.73
123 0.68
124 0.63
125 0.53
126 0.44
127 0.36
128 0.31
129 0.28
130 0.26
131 0.2
132 0.14
133 0.14
134 0.13
135 0.11
136 0.1
137 0.09
138 0.09
139 0.09
140 0.09
141 0.09
142 0.12
143 0.14
144 0.16
145 0.19
146 0.23
147 0.23
148 0.23
149 0.25
150 0.25
151 0.26
152 0.25
153 0.22
154 0.21
155 0.2
156 0.2
157 0.18
158 0.13
159 0.1
160 0.09
161 0.11
162 0.17
163 0.18
164 0.21
165 0.25
166 0.28
167 0.3
168 0.35
169 0.36
170 0.33
171 0.35
172 0.34
173 0.31
174 0.29
175 0.27
176 0.22
177 0.2
178 0.15
179 0.13
180 0.11
181 0.08
182 0.08
183 0.09
184 0.08
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.05
192 0.05
193 0.05
194 0.04
195 0.04
196 0.03
197 0.04
198 0.04
199 0.06
200 0.07
201 0.07
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.07
209 0.08
210 0.09
211 0.09
212 0.11
213 0.12
214 0.12
215 0.13
216 0.15