Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FE20

Protein Details
Accession A0A2I2FE20    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-73SPSSHKCPKPGCKKSCSRRDNLKVHVRRVHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 10, nucl 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MLCLSNGACRGDAGQPLRCEWDGCYVEFGRRAELKRHVDTLHISPSSHKCPKPGCKKSCSRRDNLKVHVRRVHGQNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.28
4 0.32
5 0.3
6 0.28
7 0.23
8 0.28
9 0.24
10 0.23
11 0.26
12 0.22
13 0.24
14 0.27
15 0.26
16 0.2
17 0.22
18 0.24
19 0.25
20 0.33
21 0.37
22 0.35
23 0.37
24 0.34
25 0.32
26 0.32
27 0.3
28 0.27
29 0.21
30 0.19
31 0.2
32 0.25
33 0.31
34 0.35
35 0.34
36 0.34
37 0.41
38 0.52
39 0.59
40 0.66
41 0.65
42 0.67
43 0.77
44 0.83
45 0.85
46 0.82
47 0.79
48 0.8
49 0.83
50 0.82
51 0.81
52 0.82
53 0.79
54 0.8
55 0.78
56 0.73
57 0.7