Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FHZ5

Protein Details
Accession A0A2I2FHZ5   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-39LWKTPWRISSPQKARQRKRLRAVDQVVHydrophilic
74-106KYTIFDKKERRYRKSIHKLPKWTRVSQRVNPPGHydrophilic
NLS Segment(s)
PositionSequence
82-90ERRYRKSIH
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKASSPLFGGLLWKTPWRISSPQKARQRKRLRAVDQVVDTVAAALARQGQSTKSINRWYDEMPREQEMLPKDKYTIFDKKERRYRKSIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.21
4 0.23
5 0.25
6 0.31
7 0.35
8 0.45
9 0.52
10 0.6
11 0.68
12 0.77
13 0.8
14 0.84
15 0.87
16 0.85
17 0.86
18 0.87
19 0.82
20 0.81
21 0.78
22 0.72
23 0.63
24 0.53
25 0.43
26 0.32
27 0.26
28 0.16
29 0.11
30 0.05
31 0.04
32 0.03
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07
38 0.1
39 0.13
40 0.15
41 0.17
42 0.23
43 0.24
44 0.25
45 0.27
46 0.25
47 0.31
48 0.32
49 0.32
50 0.29
51 0.3
52 0.3
53 0.28
54 0.3
55 0.25
56 0.27
57 0.25
58 0.22
59 0.22
60 0.22
61 0.25
62 0.27
63 0.33
64 0.32
65 0.4
66 0.48
67 0.56
68 0.65
69 0.71
70 0.72
71 0.72
72 0.77
73 0.79
74 0.82
75 0.82
76 0.83
77 0.83
78 0.87
79 0.87
80 0.89
81 0.84
82 0.81
83 0.81
84 0.81
85 0.8
86 0.78
87 0.8